DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and CLD1

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_011625.3 Gene:CLD1 / 853007 SGDID:S000003342 Length:445 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:42/183 - (22%)
Similarity:73/183 - (39%) Gaps:43/183 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TKSLRSLPF-PAGKILRTQLVVRREYSSEIPDPVELSFDSYTGE---NP-ETSPP------LLTY 58
            |:.|::||| |.....:|..::|.....|         .:|..|   .| :||.|      |:..
Yeast    91 TELLKTLPFYPTPSESKTARLIRTVVDDE---------GNYINEFCIRPRKTSVPEADLKHLVFI 146

  Fly    59 HGLFGSK-----QNWRGISKALVRKVSRKVYAIDVRNHG---------ESPHSSVHNSKA-MSED 108
            || :|:.     :|:..|.   :......::|||:..:|         |.|..::|:.:. ..|.
Yeast   147 HG-YGAGLGFFIKNFEDIP---LLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHER 207

  Fly   109 LRLFMEQRSHPNA----ACMGHSMGGRSMMYFARKYPELVERLIVVDISPISV 157
            :..:..:|:..|.    ..|.||:|...|..:.:||.|......::..||..|
Yeast   208 IHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILCSPAGV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 33/149 (22%)
Abhydrolase_5 54..>151 CDD:289465 25/121 (21%)
Abhydrolase <253..287 CDD:304388
CLD1NP_011625.3 PLN02894 103..439 CDD:215484 36/171 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.