DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and EAT1

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_011529.1 Gene:EAT1 / 852898 SGDID:S000003247 Length:328 Species:Saccharomyces cerevisiae


Alignment Length:356 Identity:71/356 - (19%)
Similarity:135/356 - (37%) Gaps:81/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRLTKSLRSLPFPAGKILRTQLVVRREYSSEIPDPVELSFDSYTGENPETSPPLLTYHGLFGSK 65
            |.||..: ::||:   ||:......|....|::...::.          |..|.::..|||.||.
Yeast     1 MSRLAHN-KALPY---KIIVDLSFHRTRLPSDVSSLIKF----------EQRPAIINIHGLLGSH 51

  Fly    66 QNWRGISKALVRKVSRKVYAIDVRNHGESPHSSVHNSKAMSEDLRLFMEQR---SHPNAACMGHS 127
            ..:..::|.|.||:...::::||||||.||.:..::...::.||..|:|..   ..| ...:|.|
Yeast    52 VMFHSLNKLLSRKLDADIFSVDVRNHGISPKAIPYDYTTLTNDLIYFIETHIGLERP-IYLLGFS 115

  Fly   128 MGGRSMMYFARKYPEL-VERLIVVDISPISVPRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIARE 191
            |||: :......|..: :.:.|.:|:.|...|.....:.:.:|.::.: :...:.:..|....::
Yeast   116 MGGK-IALLTTLYKNINIRKCISIDLPPYETPELDPMILQNYDLIMRI-IRRDVKILRGSPSWQK 178

  Fly   192 KLLKATEDETVDFIMLNLRKNPDTGAFSWACNAHVLREFLTRFDKYQSN----------LEELPP 246
            |:|     |....:..|.||          |...|...|...|...:||          .::..|
Yeast   179 KVL-----ELFKSLECNKRK----------CGGAVALYFANGFLSVKSNNVHQAQLHYEQQQHDP 228

  Fly   247 YTGPTTFICGTRSPYMRREQWPQIQKM----------------------------------FPNS 277
            |...:..:....:.....::||.:...                                  ||.:
Yeast   229 YINYSMPLSSMPNLLDEVKKWPDLSNQRDFFQKGTASRKVLFMKGLQSNFINNDYSLLRYNFPCA 293

  Fly   278 EIHWLDAGHLVHFEKPQE-FLTIVSEFLNRT 307
            ::...:.||.:..|.|:: |..|::.|...|
Yeast   294 DVREFNTGHNLLLENPEDSFKCILNFFAEET 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 61/315 (19%)
Abhydrolase_5 54..>151 CDD:289465 29/100 (29%)
Abhydrolase <253..287 CDD:304388 5/67 (7%)
EAT1NP_011529.1 Abhydrolase_1 39..309 CDD:395444 56/287 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62887
OrthoFinder 1 1.000 - - FOG0001908
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.