DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and AT5G38360

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001318695.1 Gene:AT5G38360 / 833818 AraportID:AT5G38360 Length:337 Species:Arabidopsis thaliana


Alignment Length:177 Identity:40/177 - (22%)
Similarity:68/177 - (38%) Gaps:59/177 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TKSLRSLPFPAGKILRTQLVVRREYSSEIPDPVELSFDSYTGENPETSPPLLTYHGLFGS----K 65
            |:.|..|  |:|  |:.:::.:|:..||                 ..:|||:..||.:.:    .
plant    40 TRLLHKL--PSG--LKMEVIEQRKSKSE-----------------RENPPLVFVHGSYHAAWCWA 83

  Fly    66 QNW------RGISKALVRKVSRKVYAIDVRNHGES--PHSSVHNS-KAMSEDLRLFMEQR--SHP 119
            :||      .|...          ||:.:...|||  |..:|..: :..:.|:..|:|..  |.|
plant    84 ENWLPFFSSSGFDS----------YAVSLLGQGESDEPLGTVAGTLQTHASDIADFIESNLGSSP 138

  Fly   120 NAACMGHSMGGRSMMYF------------ARKYPELVERLIVVDISP 154
             ...:|||.||..:.|:            ...:|||...::|..:.|
plant   139 -PVLVGHSFGGLIVQYYLANIVNKRSLGTENAFPELSGAVMVCSVPP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 31/144 (22%)
Abhydrolase_5 54..>151 CDD:289465 29/123 (24%)
Abhydrolase <253..287 CDD:304388
AT5G38360NP_001318695.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.