DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and AT3G52570

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_190825.2 Gene:AT3G52570 / 824423 AraportID:AT3G52570 Length:335 Species:Arabidopsis thaliana


Alignment Length:296 Identity:73/296 - (24%)
Similarity:136/296 - (45%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVS------RKVYAIDVRNHGES--------P 95
            |..:.|:....|..|||.||.:|||..|::|...:|      .|:..:|:||||.|        |
plant    46 TSGDRESESTALILHGLLGSGRNWRSFSRSLASSLSVSSASDWKMILVDLRNHGRSAEVEGLNPP 110

  Fly    96 HSSVHNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSMMYFARK-----YPELV---ERLIVVDI 152
            |..|:::|.:::.::  ....:.|:.. :|||:||:..:.|...     :.|..   ::|.|:|.
plant   111 HDLVNSAKDLADLVK--ASGWNWPDVV-IGHSLGGKVALQFMESCARGDFGESASPPKQLWVLDS 172

  Fly   153 SP--ISVPRSTGEMTEIFDAMVSLDLS-PSMSMSEGRKIAREKLLKATEDETV-DFIMLNLRKNP 213
            .|  :...:|.||:.::...:.||..| ||      ||...:::::.....:: ::|..||:::.
plant   173 VPGEVKAEKSDGEVEKVLKTLQSLPSSIPS------RKWLVDRMVELGFSRSLSEWIGSNLKRSG 231

  Fly   214 DTGAFSWACNAHVLREFLTRFDKYQS----NLEELPPYTGPTTFICGTRSPYMRREQWPQIQKMF 274
            |:.  :|..|   |...:..|:.|:.    :|.|.||......|:...:|.....:...:::.:.
plant   232 DSE--TWTFN---LDGAVQMFNSYRETSYWSLLENPPKETEINFVIAEKSDRWDNDTTKRLETIA 291

  Fly   275 PNSE--------IHWL-DAGHLVHFEKPQEFLTIVS 301
            ...:        .|.| ::||.||.:.|:..|.|||
plant   292 NQRQNVAEGKVATHLLRNSGHWVHTDNPKGLLEIVS 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 73/296 (25%)
Abhydrolase_5 54..>151 CDD:289465 33/118 (28%)
Abhydrolase <253..287 CDD:304388 5/42 (12%)
AT3G52570NP_190825.2 bchO_mg_che_rel 44..328 CDD:132100 73/296 (25%)
Abhydrolase 59..>155 CDD:304388 29/98 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3999
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 1 1.000 - - FOG0001908
OrthoInspector 1 1.000 - - otm3134
orthoMCL 1 0.900 - - OOG6_101420
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.680

Return to query results.
Submit another query.