DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and AT3G10840

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_187695.3 Gene:AT3G10840 / 820253 AraportID:AT3G10840 Length:466 Species:Arabidopsis thaliana


Alignment Length:364 Identity:86/364 - (23%)
Similarity:128/364 - (35%) Gaps:114/364 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EIPDPVELSFD-----SYTGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAID---- 87
            ::.||..||.|     .:..|.|:|..|::..||...|..:|..:.|.|.|.||.||.|.|    
plant   105 KVLDPHTLSDDVSNTSPHAQETPKTKFPMILLHGFGASVFSWNRVMKPLARLVSSKVLAFDRPAF 169

  Fly    88 ------------VRNHGE--SPHSSVHNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSMM--YF 136
                        ..|..:  :|:|.|::...    ...|::..:...|..:|||.|....:  ||
plant   170 GLTSRIFHPFSGATNDAKPLNPYSMVYSVLT----TLYFIDVLAADKAILVGHSAGCPVALDAYF 230

  Fly   137 ARKYPELVERLIVVDISP-ISVPR-----STGEMTEIFDAMVSLDLSPSMSMSEGRKIAREKLLK 195
              :.||.|..||:|  :| |..||     ..||..: .:|..|..|...:.:::|  :.|..|..
plant   231 --EAPERVAALILV--APAIFAPRPVATTDAGENRD-KEAPTSNFLGTLVELTKG--VIRAVLRV 288

  Fly   196 ATEDETVDFIMLNLRKNPDTGAFSWACNAHVLREFL-------------------TRFDKYQSNL 241
            .|.       |.|:..:....|.     |..||.||                   ..:|..|...
plant   289 VTG-------MANMLSSLYKKAL-----AAFLRSFLGVMLVRMAINKFGVTAVRNAWYDSKQVTD 341

  Fly   242 EELPPYTGP----------TTFICGT---------RSPYMRREQ-------------------W- 267
            ..:..||.|          ..|...|         :.|..:|.|                   | 
plant   342 HVVQGYTKPLKAKGWDKALVEFTVATLTDNNGSEKKLPLSKRLQEIKCPVLIVTGDTDRIVPAWN 406

  Fly   268 -PQIQKMFPNSEIHWL-DAGHLVHFEKPQEFLTIVSEFL 304
             .::.:..|.|....: ..|||...|||.||::||::||
plant   407 AERLARAIPGSVFEVIKKCGHLPQEEKPDEFISIVAKFL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 84/358 (23%)
Abhydrolase_5 54..>151 CDD:289465 31/116 (27%)
Abhydrolase <253..287 CDD:304388 9/64 (14%)
AT3G10840NP_187695.3 MhpC 111..445 CDD:223669 82/356 (23%)
Abhydrolase_5 132..292 CDD:289465 45/177 (25%)
Abhydrolase_5 <379..427 CDD:289465 6/47 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I2485
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.