DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and BPHL

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_004323.2 Gene:BPHL / 670 HGNCID:1094 Length:291 Species:Homo sapiens


Alignment Length:284 Identity:59/284 - (20%)
Similarity:102/284 - (35%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VELSFDSYTGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAI---DVRNHGES---- 94
            |:|.:.. |||....   :|...|:.||.:...|   ..::.:::|::.:   |.|.:|.|    
Human    49 VQLHYQQ-TGEGDHA---VLLLPGMLGSGETDFG---PQLKNLNKKLFTVVAWDPRGYGHSRPPD 106

  Fly    95 ---PHSSVHNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISPIS 156
               |..........:.||   |:.......:.:|.|.||.:.:..|.|||..:.::::...:.. 
Human   107 RDFPADFFERDAKDAVDL---MKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAY- 167

  Fly   157 VPRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIAREKL-----LKATEDETVDFIMLNLRKNPDTG 216
               .|.|     |:|:...:......||..:...|.|     ...|.::.||.|. ..:..||  
Human   168 ---VTDE-----DSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIR-QFKHLPD-- 221

  Fly   217 AFSWACNAHVLREFLTRFDKYQSNLEELPPYTGPTTFICGTRSPYMRREQWPQIQKMFPNSEIHW 281
                   .::.|..             ||....|...:.|.:.|.:.|.....|.|....|.:|.
Human   222 -------GNICRHL-------------LPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHL 266

  Fly   282 LDAG-HLVHFEKPQEFLTIVSEFL 304
            :..| |.:|.....||..:..:||
Human   267 MPEGKHNLHLRFADEFNKLAEDFL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 58/283 (20%)
Abhydrolase_5 54..>151 CDD:289465 22/106 (21%)
Abhydrolase <253..287 CDD:304388 8/34 (24%)
BPHLNP_004323.2 MhpC 44..291 CDD:223669 59/284 (21%)
Abhydrolase 58..259 CDD:304388 46/241 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.