DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and LOC570571

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_021330474.1 Gene:LOC570571 / 570571 -ID:- Length:355 Species:Danio rerio


Alignment Length:147 Identity:36/147 - (24%)
Similarity:64/147 - (43%) Gaps:20/147 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QLVVRREYSSEIPDPVELSFDS------------YTGENPETSPPLLTYHGLFGS--KQNWRGIS 72
            |..||::..:.:.|| ||...:            |..:.....|.:|..||...:  :.:||  .
Zfish    56 QWTVRKKPPACLQDP-ELGDHAFLKGRSSGLRFHYVTKGDHKKPLMLFLHGFPENCCRYSWR--H 117

  Fly    73 KALVRKVSRKVYAIDVRNHGESP---HSSVHNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSMM 134
            :.|.........|:|:|..|.|.   ....:..:|:..|:|..::|..|.:...:||..||....
Zfish   118 QLLEFSGDFHTVALDLRGCGASDAPVRLEDYLLEALLYDIRDTVDQLGHTSCILVGHDWGGMLAW 182

  Fly   135 YFARKYPELVERLIVVD 151
            :||.:.|::|:.|||::
Zfish   183 HFALERPDMVQLLIVMN 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 31/131 (24%)
Abhydrolase_5 54..>151 CDD:289465 27/101 (27%)
Abhydrolase <253..287 CDD:304388
LOC570571XP_021330474.1 MhpC 82..341 CDD:223669 29/120 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.