DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and serhl

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_031755888.1 Gene:serhl / 493433 XenbaseID:XB-GENE-5751959 Length:309 Species:Xenopus tropicalis


Alignment Length:266 Identity:56/266 - (21%)
Similarity:101/266 - (37%) Gaps:72/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AIDVRNHGESPHSS-----------VHNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSMMYFAR 138
            |:|...||.|.|..           :...||:   :.|..|:     ...:|||:||......|.
 Frog    64 ALDFTGHGLSSHKPPGARYDFIDFVIDAYKAL---VALGREK-----VTVLGHSLGGLVGTLLAS 120

  Fly   139 KYPELVERLIVVDISPISVPRSTGEMTEIF-DAMVSLDLSPSMSMSEGRKI-----AREKLLKAT 197
            .|||::|.:|::|.... .|:|:......| |:::|...:   .:::.:|.     |.::||.|.
 Frog   121 IYPEIIENVILLDTYGF-YPQSSHIFISHFKDSILSYVCT---DVAQVQKTYTPGDALQRLLIAN 181

  Fly   198 EDETVDFIMLNLRKN----PDTGAFS----------------WACN------AHVLREFLTRFDK 236
            :..||:.:.:.|::.    ||...|:                ..|:      |:||.  :...|.
 Frog   182 KSLTVESVKILLQRGTKEMPDGLTFTRDPRICLMSMPPLTLELCCHMMKTIQANVLA--IIASDG 244

  Fly   237 YQSNLE-ELPPYTGPTTFICGTRSPYMRREQWPQIQKMFPNSEIHWLDAGHLVHFEKPQEFLTIV 300
            ..|..| :..|..|....           .:|.:..:.|   ::..::..|.||....:....|:
 Frog   245 LMSEKENQFDPRDGTILL-----------SRWQEYVECF---QLAAVNGNHFVHLNNAENVSGII 295

  Fly   301 SEFLNR 306
            |.||.:
 Frog   296 SSFLQK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 55/263 (21%)
Abhydrolase_5 54..>151 CDD:289465 21/76 (28%)
Abhydrolase <253..287 CDD:304388 2/33 (6%)
serhlXP_031755888.1 Abhydrolase_1 35..>134 CDD:395444 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.