DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and CG5704

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001286912.1 Gene:CG5704 / 48613 FlyBaseID:FBgn0026570 Length:335 Species:Drosophila melanogaster


Alignment Length:284 Identity:57/284 - (20%)
Similarity:101/284 - (35%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGESPHSSVHNSKAMSE---DLRLFMEQ 115
            |:|..||...:...:..:...|...:.  |..||:..||.|.|.......::.|   .:.|.|::
  Fly    33 PILAIHGWLDNLGTFDRLIPLLPDYLG--VLCIDLPGHGRSSHLPPGMYYSVYEYVFTIPLVMKE 95

  Fly   116 RSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISPISVPRSTGEMTEIFDAMVSLDLSPSM 180
            ......:.:|||:||.....:|...|..|:.::.:||           :..:.:.:..:|||...
  Fly    96 YGWSKVSLIGHSLGGVLSFIYASLAPHTVDMIVSLDI-----------LLPLRNDIDYMDLSIEK 149

  Fly   181 SMSEGRKIAREKLLKATEDETVDFIMLNLRKNPDTGAF---SWACNAHVLREFLTRFDKYQSNLE 242
            .:.   .:.|:||  ....|...:....|.|....|:|   |.....|:|...|.:...|.....
  Fly   150 QLV---NVERQKL--GNYIEPPSYTHNQLGKVLAAGSFNSVSPELAKHLLHRQLAKSKLYPERFY 209

  Fly   243 -------------ELPPYTG----------PTTFICGTRSPYM---RREQWPQIQKMFPNSEIHW 281
                         ::....|          |...|.|:.|||:   ..|....:.|..|:.|.:.
  Fly   210 FTRDIRVKYYHYIDIDDSLGAEMARRIIKKPYLIIKGSLSPYLSVRNNEAISILAKDNPHFEFYE 274

  Fly   282 LDAG-HLVHFEKPQEFLTIVSEFL 304
            ::.| |.:|....:|....:..|:
  Fly   275 VENGTHHLHLHAAEECAGYIVPFI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 57/284 (20%)
Abhydrolase_5 54..>151 CDD:289465 23/99 (23%)
Abhydrolase <253..287 CDD:304388 10/37 (27%)
CG5704NP_001286912.1 MhpC 32..301 CDD:223669 57/284 (20%)
Abhydrolase_5 33..>121 CDD:289465 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.