DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and CG7632

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster


Alignment Length:334 Identity:73/334 - (21%)
Similarity:134/334 - (40%) Gaps:72/334 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PFPAGKILRTQLVVRREYSSEIPDPVELSFDSYTGENPETSPPLLTYHGLFGSKQNWRGISKALV 76
            ||   |||       .::..||..||.....|.....|:...|::..||...:...:..::..|.
  Fly    26 PF---KIL-------NKHFDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLP 80

  Fly    77 RKVSRKVYAIDVRNHGES----PHSSVHNSKAMSEDL----RLFMEQRSHPNAACMGHSMGGRSM 133
            ..:|  ..:||...||.|    |.:|.|     |.||    |..||:.:....:.:.|||...:.
  Fly    81 SHLS--FLSIDAPGHGLSSWLPPGTSYH-----SIDLVLITRRLMEEYNWDKISILAHSMSSING 138

  Fly   134 MYFARKYPELVERLIVVDISPISVPRSTG---EMTEIFDAMVSLDLSPSMSMSEGRKIAREKLLK 195
            ..|:..:|:.|:..:.:|:....|..:.|   .:||..::.:.|:               .:|..
  Fly   139 FVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERIESALKLE---------------RRLKS 188

  Fly   196 ATEDETVDF--IMLNLRKNPDTGAFSWACNAHVLRE-----------FLTRFDKYQSNL-----E 242
            .:|....|:  ::..|.:..:......||...:.|.           :.:|.::.:|:|     :
  Fly   189 GSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFYTLHQ 253

  Fly   243 ELPPYTG-----PTTFICGTRSPYMRREQW-----PQIQKMFPNSEIHWLDAGHLVHFEKPQEFL 297
            |:|....     |..||...::||..|:::     .::||. |..|.|.::..|.||..:|::..
  Fly   254 EVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKN-PLFEYHEVEGTHHVHLNEPEKVA 317

  Fly   298 TIVSEFLNR 306
            .|::.|:||
  Fly   318 PIINSFINR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 62/305 (20%)
Abhydrolase_5 54..>151 CDD:289465 25/104 (24%)
Abhydrolase <253..287 CDD:304388 10/38 (26%)
CG7632NP_649302.1 MhpC 57..326 CDD:223669 60/291 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.