DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and Ephx4

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001001804.2 Gene:Ephx4 / 384214 MGIID:2686228 Length:359 Species:Mus musculus


Alignment Length:279 Identity:63/279 - (22%)
Similarity:95/279 - (34%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YTGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGES---PHSSVHNSKAM 105
            |........|.:|..||......:||...:..  |...:|.|:|:|.:|||   .|...:....:
Mouse    83 YVAAGERGKPLMLLLHGFPEFWYSWRHQLREF--KSEYRVVALDLRGYGESDAPAHQESYKLDCL 145

  Fly   106 SEDLRLFMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISPISV------------- 157
            ..|::..::...:.....:||..||......|..|||::.:|||::....||             
Mouse   146 IADIKDILDSLGYSKCVLIGHDWGGMIAWLIAVCYPEMIMKLIVINFPHPSVFTEYILRHPAQLF 210

  Fly   158 ----------PRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIAREKLLKATED-ETVDFIMLNLRK 211
                      ||....|..|.|......|..|.|...||| .|:   ..||| |...::.     
Mouse   211 RSSFYYFFQIPRFPEFMFSINDFKALKHLFTSQSTGIGRK-GRQ---LTTEDLEAYVYVF----- 266

  Fly   212 NPDTGAFSWACNAHVLREFLTRFDKYQSNLEELP----PYTGPTTFICGTRSPYMRREQWPQIQK 272
             ...||.|...|            .|::....||    ..|.||..:.|....:|..|. .::.|
Mouse   267 -SQPGALSGPIN------------HYRNIFSCLPLKHHMVTTPTLLLWGEEDAFMEVEM-AEVTK 317

  Fly   273 MFPNSEI---------HWL 282
            ::..:..         |||
Mouse   318 IYVKNYFRLTILSEGSHWL 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 63/279 (23%)
Abhydrolase_5 54..>151 CDD:289465 26/99 (26%)
Abhydrolase <253..287 CDD:304388 7/39 (18%)
Ephx4NP_001001804.2 MhpC 74..353 CDD:223669 63/279 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.