DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and CG15820

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_647696.1 Gene:CG15820 / 38277 FlyBaseID:FBgn0035312 Length:308 Species:Drosophila melanogaster


Alignment Length:289 Identity:59/289 - (20%)
Similarity:103/289 - (35%) Gaps:60/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGES---PHSSVHNSKAMSEDLRLFMEQ 115
            |:|..||...:...:..:...|...:.  |..||:..||.|   |....:|.......:...|::
  Fly    31 PILAIHGWLDNLGTFDRLIPLLPDYIG--VLCIDLPGHGRSSRLPPGVPYNVYDYVFIIPRVMKE 93

  Fly   116 RSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISPISVPRSTGEMTEIFDAMVSLDLSPSM 180
            ......:.||||:||.....:|...|..|:.:|.:|   :.:||...:.:::     :.|:    
  Fly    94 FGWSKVSLMGHSLGGVMSFMYAAMAPSTVDMIISLD---VLLPRRIEDPSKL-----TKDI---- 146

  Fly   181 SMSEGRKIAREKLLKATEDETVDFIMLNLR----KNPDTGAFSWACNAHVLREFLTRFDKYQSN- 240
               ||..:...:....||.|...|.:..||    :|.:........: |:|...:.:.:.|... 
  Fly   147 ---EGYLLEERRQADGTEHEPPSFTLSKLRETLARNSNNSVPQHLAD-HMLHRQVAKSNMYPEKV 207

  Fly   241 ---------------------LE-----ELPPYTGPTTFICGTRSPYMR---REQWPQIQKMFPN 276
                                 ||     |..||    ..|.|:.||::.   .|....:....||
  Fly   208 FFSRDGRVKFYHIFDIENGLALEMARRIEKKPY----LVIKGSLSPFVGPRCNETMSILSHDNPN 268

  Fly   277 SEIHWLDAG-HLVHFEKPQEFLTIVSEFL 304
            .|.:.::.| |.||....:|....:..|:
  Fly   269 FEFYEVEGGKHHVHLHAAEECARYIVPFI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 59/289 (20%)
Abhydrolase_5 54..>151 CDD:289465 24/99 (24%)
Abhydrolase <253..287 CDD:304388 9/37 (24%)
CG15820NP_647696.1 MhpC 24..300 CDD:223669 59/289 (20%)
Abhydrolase_5 31..>119 CDD:289465 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439873
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.