DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and Ephx3

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001102458.1 Gene:Ephx3 / 366836 RGDID:1307206 Length:415 Species:Rattus norvegicus


Alignment Length:302 Identity:65/302 - (21%)
Similarity:105/302 - (34%) Gaps:76/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YTGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSR-KVYAIDVRNHGESPHSSVHNSKAMSE 107
            |........|.:|..||.   .:||......|....|. .|.|:|:|  |.||..:..:....:.
  Rat   144 YVSAGRGNGPLMLFLHGF---PENWFSWRYQLREFQSHFHVVAVDLR--GYSPSDAPKDVDCYTV 203

  Fly   108 DLRL-----FMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISPISV--PRSTGEMT 165
            ||.|     .:....:.....:.|..|......|:..:|.||:|:|||...|:||  ..||..:.
  Rat   204 DLLLTDIKDIILGLGYSKCILVSHDWGAALAWDFSVYFPSLVDRMIVVSGPPMSVFQEYSTRHIG 268

  Fly   166 EIFDA----MVSLDLSPSMSMSEGRKIAREKLLKATEDETVDFIMLNLRK-----NPDTGAFSWA 221
            ::|.:    :..|...|            ||||..::.:.:..|..:.:|     :|        
  Rat   269 QLFRSNYIFLFQLPWLP------------EKLLSLSDFQILKSIFTHHKKGIPRLSP-------- 313

  Fly   222 CNAHVLREFLTRF----------DKYQSNLEELP----PYTGPTTFICGTRSPYMRREQWPQIQK 272
            |.   |..||..|          :.|::.....|    ..:.||..:.|.:...:::.....|:.
  Rat   314 CE---LEAFLYPFSHPGGLSGPINYYRNVFRNFPLEPKELSKPTLLLWGEKDFSLQQGLVEAIES 375

  Fly   273 MF----------PNSEIHWLDAGHLVHFEKPQEFLTIVSEFL 304
            .|          |.|. ||:...|      |:|....:..||
  Rat   376 HFVPGRLESHILPGSG-HWIPQSH------PEEMHQYMWAFL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 65/302 (22%)
Abhydrolase_5 54..>151 CDD:289465 26/102 (25%)
Abhydrolase <253..287 CDD:304388 7/43 (16%)
Ephx3NP_001102458.1 MhpC 133..406 CDD:223669 63/296 (21%)
Abhydrolase 140..413 CDD:304388 65/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.