DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and Bphl

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001032283.1 Gene:Bphl / 361239 RGDID:1307572 Length:291 Species:Rattus norvegicus


Alignment Length:267 Identity:56/267 - (20%)
Similarity:98/267 - (36%) Gaps:56/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLTYHGLFGS-KQNWRGISKALVRKVSRKVYAIDVRNHGES-------PHSSVHNSKAMSEDLRL 111
            :|...|:.|| |.::....::|.:|....| |.|.|.:|||       |..........:.||  
  Rat    63 VLLLPGMLGSGKTDFAPQLQSLNKKRFTLV-AWDPRGYGESRPPDRDFPRDFFERDAKDAVDL-- 124

  Fly   112 FMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISPISVPRSTGEMTEIFDAMVSLDL 176
             |:.......:.:|.|.||.:.:..|.|||..:.::::...:..    .|.|.:.|:..:     
  Rat   125 -MKALQFKQVSLLGWSDGGITALIAAAKYPSYIRKMVIWGANAY----VTEEDSRIYQGI----- 179

  Fly   177 SPSMSMSEGRKIAREKL--------LKATEDETVDFIMLNLRKNPDTGAFSWACNAHVLREFLTR 233
               ..:|:..:.||:.|        ...|.::.||.|          ..|....:.::.|..   
  Rat   180 ---RDVSKWSEKARKPLEALYGHDYFAKTCEKWVDGI----------NQFKHLPDGNICRHL--- 228

  Fly   234 FDKYQSNLEELPPYTGPTTFICGTRSPYMRREQWPQIQKMFPNSEIHWLDAG-HLVHFEKPQEFL 297
                      ||....||..:.|.:.|.:.|.....:.:....|.:|.:..| |.:|.....||.
  Rat   229 ----------LPLIQCPTLIVHGEKDPLVPRFHADFLLEHVKGSRLHLMPEGKHNLHLRFADEFN 283

  Fly   298 TIVSEFL 304
            .:|.:||
  Rat   284 RLVEDFL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 56/267 (21%)
Abhydrolase_5 54..>151 CDD:289465 26/103 (25%)
Abhydrolase <253..287 CDD:304388 6/34 (18%)
BphlNP_001032283.1 MhpC 44..291 CDD:223669 56/267 (21%)
Abhydrolase 58..259 CDD:304388 46/234 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.