DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and kraken

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001259847.1 Gene:kraken / 33265 FlyBaseID:FBgn0020545 Length:331 Species:Drosophila melanogaster


Alignment Length:246 Identity:52/246 - (21%)
Similarity:98/246 - (39%) Gaps:42/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EYSSEIPDPVEL----SFDSYTGENP-----------ETSPPLLTYHGLFGSKQNWRGISKALVR 77
            |.:.:..:|::|    |::.::...|           :...|::..||       |:....:..|
  Fly    22 ETNGQTEEPLQLLGEDSWEEFSIAVPWGTVEAKWWGSKERQPIIALHG-------WQDNCGSFDR 79

  Fly    78 -----KVSRKVYAIDVRNHGESPHSSVHNSKAMSED----LRLFMEQRSHPNAACMGHSMGGRSM 133
                 .....:.|||:..||:|.|..:.....:..|    :|..:.:.:..|...:|||:||...
  Fly    80 LCPLLPADTSILAIDLPGHGKSSHYPMGMQYFIFWDGICLIRRIVRKYNWKNVTLLGHSLGGALT 144

  Fly   134 MYFARKYPELVERLIVVDISPISVPRSTGEMTE----IFDAMVSLDL-----SPSMSMSEGRKIA 189
            ..:|..:|..||:||.:||:..:| |.|..|.|    ..|..:..:.     .|..|..|..|:.
  Fly   145 FMYAASFPTEVEKLINIDIAGPTV-RGTQRMAEGTGRALDKFLDYETLPESKQPCYSYDEMIKLV 208

  Fly   190 REKLLKATEDETVDFIM-LNLRKNPDTGAFSWACNAHVLREFLTRFDKYQS 239
            .:....:.::.:|..:| ..:|.||....:.:|.:..:....|..|...|:
  Fly   209 LDAYDGSVDEPSVRVLMNRGMRHNPSKNGYLFARDLRLKVSLLGMFTAEQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 50/236 (21%)
Abhydrolase_5 54..>151 CDD:289465 26/105 (25%)
Abhydrolase <253..287 CDD:304388
krakenNP_001259847.1 MhpC 61..329 CDD:223669 47/207 (23%)
Abhydrolase_5 63..>159 CDD:289465 24/102 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.