DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and Abhd8

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001100771.1 Gene:Abhd8 / 306338 RGDID:1305693 Length:441 Species:Rattus norvegicus


Alignment Length:265 Identity:65/265 - (24%)
Similarity:118/265 - (44%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGESPHSSV---HNSKAMSEDLRLFMEQR 116
            |...||:.||...|:......|| :..:|.|.|:..||.|....|   :...|::||:|....:.
  Rat   170 LFFIHGVGGSLAIWKEQLDFFVR-LGYEVVAPDLAGHGASSAPQVAAAYTFYALAEDMRAIFTRY 233

  Fly   117 SHPNAACMGHSMGGRSMMYFARKYPELVERLIVVD-ISPISVPRSTGEMTEIFD--AMVSLDLSP 178
            :......:|||.|.....:.|.:||:||.::|::: ..|.::..|   :..||:  ..|...|||
  Rat   234 AKKRNVLIGHSYGVSFCTFLAHEYPDLVHKVIMINGGGPTALEPS---LCSIFNMPTCVLHCLSP 295

  Fly   179 SMSMS-----EGRKIAREK-LLKATEDETVDFIMLNLRKNPDTGAFSWACNAHVLREFLTRFDKY 237
            .::.|     ..|:.|:|| |||                  :..||:  .::.|||..::  .:|
  Rat   296 CLAWSFLKAGFARQGAKEKQLLK------------------EGNAFN--VSSFVLRAMMS--GQY 338

  Fly   238 QSNLEEL--PPYTGPTTFICGTRSPYMRREQWPQIQKMFPNSEIHWLDAG-HLVHFEKPQEFLTI 299
            ....:|:  ...|.|...:.|....::..|:..::.::...:.:..::.| |:|..|.|:...|:
  Rat   339 WPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIEEGSHMVMLECPETVNTL 403

  Fly   300 VSEFL 304
            :.|||
  Rat   404 LHEFL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 65/265 (25%)
Abhydrolase_5 54..>151 CDD:289465 29/98 (30%)
Abhydrolase <253..287 CDD:304388 3/34 (9%)
Abhd8NP_001100771.1 MhpC 149..408 CDD:223669 63/263 (24%)
Abhydrolase_5 168..390 CDD:289465 57/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2382
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.