DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and Abhd6

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001007681.1 Gene:Abhd6 / 305795 RGDID:1359323 Length:337 Species:Rattus norvegicus


Alignment Length:283 Identity:64/283 - (22%)
Similarity:109/283 - (38%) Gaps:42/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SYTGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGESPHSSVHNSKAMSE 107
            |:.| .|...|.:|..||....|..|..:.|.|.:.:  .:..:|:..|..:..||:       :
  Rat    63 SFRG-RPGHKPSVLMLHGFSAHKDMWLSVVKFLPKNL--HLVCVDMPGHEGTTRSSL-------D 117

  Fly   108 DLRLFME-QRSHPNAACM----------GHSMGGRSMMYFARKYPELVERLIVVDISPISVPRST 161
            ||.:..: :|.|....|:          |.||||.....:|..||..|..|.:|  .|..:..||
  Rat   118 DLSIVGQVKRIHQFVECLKLNKKPFHLIGTSMGGNVAGVYAAYYPSDVCSLSLV--CPAGLQYST 180

  Fly   162 G-----EMTEIFD--AMVSLDLSPSM--SMSEGRKIAREKLLKATEDETVDFIMLNLRKNPDTGA 217
            .     .:.|:.|  |...:.|.||.  .|||..::......|..:......:.:.:..|     
  Rat   181 DNRFVQRLKELEDSAATQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN----- 240

  Fly   218 FSWACNAHVLREFLTRFDKYQSNLEELPPYTGPTTFICGTRSPYMRREQWPQIQKMFPNSEIHWL 282
               :....:..|.::...:|..: |.:.....||..|.|.:...:.......:.|...||::..|
  Rat   241 ---SFYRKLFLEIVSEKSRYSLH-ENMDKIKVPTQIIWGKQDQVLDVSGADILAKSITNSQVEVL 301

  Fly   283 D-AGHLVHFEKPQEFLTIVSEFL 304
            : .||.|..|:|::...:|.:||
  Rat   302 ENCGHSVVMERPRKTAKLVVDFL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 64/283 (23%)
Abhydrolase_5 54..>151 CDD:289465 26/107 (24%)
Abhydrolase <253..287 CDD:304388 7/34 (21%)
Abhd6NP_001007681.1 MhpC 51..327 CDD:223669 64/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.