DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and mest

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_571118.2 Gene:mest / 30242 ZFINID:ZDB-GENE-991111-5 Length:344 Species:Danio rerio


Alignment Length:301 Identity:62/301 - (20%)
Similarity:111/301 - (36%) Gaps:81/301 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGES----PHS-SVHNSKAMSEDLR 110
            :|..|:..||...|..:|..|..:|.::.:| |.|:|....|.|    ||. |:....::.|.|.
Zfish    77 SSDVLVLLHGFPTSSYDWYKIWDSLTQRFNR-VIALDFLGFGFSDKPRPHRYSIFEQASVVEALV 140

  Fly   111 LFM---EQR----SHP-----------------------NAACMGHSMGGRSMMYFARKYPELVE 145
            ..:   |||    ||.                       |:.|:  |.||   ::....:|..::
Zfish   141 AHLGLSEQRINILSHDYGDTVALELLYRSDHNRSGHIIVNSLCL--SNGG---IFPETHHPRFLQ 200

  Fly   146 RLIVVDISPISVPRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIAREKLLKATEDETVDFIMLNLR 210
            :::          :.:|.::.:...:::..|     .|.|.|.......:.||.|..| :...:|
Zfish   201 KVL----------KDSGFISPVLTRLMNFQL-----FSRGIKEVFGPYTQPTEAEVWD-MWTGIR 249

  Fly   211 KNPDTGAFSWACNAHVLREFLTRFDKYQSNLEELPPYTG-------PTTFICGTRSPYMRREQWP 268
            .|          :.:::.:.|.::  ....|:....:.|       |...|.|...|.....|:.
Zfish   250 FN----------DGNLVMDSLLQY--INQRLKHRERWVGALTSTLTPLHMIYGPLDPVNPHPQFL 302

  Fly   269 QI-QKMFPNSEIHWLDAGHLVHF---EKPQEFLTIVSEFLN 305
            |: ||:...|.:..||. |:.|:   |.|..|......|:|
Zfish   303 QLYQKLVQRSTVSVLDE-HVSHYPQLEDPTGFFNAYLSFIN 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 61/299 (20%)
Abhydrolase_5 54..>151 CDD:289465 29/131 (22%)
Abhydrolase <253..287 CDD:304388 10/34 (29%)
mestNP_571118.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.