DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and EPHX4

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_775838.3 Gene:EPHX4 / 253152 HGNCID:23758 Length:362 Species:Homo sapiens


Alignment Length:279 Identity:60/279 - (21%)
Similarity:93/279 - (33%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YTGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGESP---HSSVHNSKAM 105
            |........|.:|..||......:||...:..  |...:|.|:|:|.:||:.   |...:....:
Human    85 YVAAGERGKPLMLLLHGFPEFWYSWRYQLREF--KSEYRVVALDLRGYGETDAPIHRQNYKLDCL 147

  Fly   106 SEDLRLFMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISP---------------- 154
            ..|::..::...:.....:||..||......|..|||:|.:|||::...                
Human   148 ITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLIVINFPHPNVFTEYILRHPAQLL 212

  Fly   155 -------ISVPRSTGEMTEIFDAMVSLDLSPSMSMSEGRKIAREKLLKATED-ETVDFIMLNLRK 211
                   ..:|.....|..|.|..|...|..|.|...|||..:    ..||| |...::.     
Human   213 KSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQ----LTTEDLEAYIYVF----- 268

  Fly   212 NPDTGAFSWACNAHVLREFLTRFDKYQSNLEELP----PYTGPTTFICGTRSPYMRREQWPQIQK 272
             ...||.|...|            .|::....||    ..|.||..:.|....:|..|. .::.|
Human   269 -SQPGALSGPIN------------HYRNIFSCLPLKHHMVTTPTLLLWGENDAFMEVEM-AEVTK 319

  Fly   273 MFPNSEI---------HWL 282
            ::..:..         |||
Human   320 IYVKNYFRLTILSEASHWL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 60/279 (22%)
Abhydrolase_5 54..>151 CDD:289465 26/99 (26%)
Abhydrolase <253..287 CDD:304388 7/39 (18%)
EPHX4NP_775838.3 MhpC 76..350 CDD:223669 60/279 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.