DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and Ephx1

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001029262.1 Gene:Ephx1 / 25315 RGDID:2557 Length:455 Species:Rattus norvegicus


Alignment Length:112 Identity:26/112 - (23%)
Similarity:47/112 - (41%) Gaps:32/112 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 ATEDETVDFIMLNLRKNPDTGAFSWACNAHVLREFLTRFDKYQSNLEELPPYTGPTTFICGTRSP 260
            |.|||::         .|    |....:...:::...|.|:::::    ||..| :.|..|..|.
  Rat    42 AKEDESI---------RP----FKVETSDEEIKDLHQRIDRFRAS----PPLEG-SRFHYGFNSN 88

  Fly   261 YMRR--EQW---------PQIQKMFPN--SEIHWLDAGHLVHFEKPQ 294
            ||::  ..|         .:|...:|:  ::|..||. |.:|.:.||
  Rat    89 YMKKVVSYWRNEFDWRKQVEILNQYPHFKTKIEGLDI-HFIHVKPPQ 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 26/112 (23%)
Abhydrolase_5 54..>151 CDD:289465
Abhydrolase <253..287 CDD:304388 11/46 (24%)
Ephx1NP_001029262.1 EHN 48..157 CDD:399447 22/106 (21%)
Abhydrolase_1 142..401 CDD:395444
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.