DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and EPHX2

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001970.2 Gene:EPHX2 / 2053 HGNCID:3402 Length:555 Species:Homo sapiens


Alignment Length:313 Identity:62/313 - (19%)
Similarity:117/313 - (37%) Gaps:84/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGES---PHSSVHNSKAMSEDLRLF 112
            :.|.:...||...|..:||....||. :...:|.|:|::.:|||   |....:..:.:.:::..|
Human   257 SGPAVCLCHGFPESWYSWRYQIPALA-QAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTF 320

  Fly   113 MEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLI-----VVDISPISVPRSTGEMTEIFD--- 169
            :::.....|..:||..||..:.|.|..|||.|..:.     .:..:|...|..:.:...:||   
Human   321 LDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQL 385

  Fly   170 -----AMVSLDLSPSMS--------MSEGRKIAREKLLKA-----------------TEDETVDF 204
                 .:...:|..::|        .|:...::..|:.:|                 ||:| :.|
Human   386 YFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEE-IQF 449

  Fly   205 IMLNLRKNPDTGA----------FSWACNAHVLREFLTRFDKYQSNLEELPPYTGPTTFICGTRS 259
            .:...:|:...|.          :.|||.: :.|:.|.                 |...:...:.
Human   450 YVQQFKKSGFRGPLNWYRNMERNWKWACKS-LGRKILI-----------------PALMVTAEKD 496

  Fly   260 ----PYMRR--EQW-PQIQKMFPNSEIHWLDAGHLVHFEKPQEFLTIVSEFLN 305
                |.|.:  |.| |.:::.      |..|.||....:||.|...|:.::|:
Human   497 FVLVPQMSQHMEDWIPHLKRG------HIEDCGHWTQMDKPTEVNQILIKWLD 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 61/311 (20%)
Abhydrolase_5 54..>151 CDD:289465 26/104 (25%)
Abhydrolase <253..287 CDD:304388 8/40 (20%)
EPHX2NP_001970.2 Phosphatase 1..224
HAD_sEH-N_like 3..214 CDD:319790
Phosphate binding. /evidence=ECO:0000269|PubMed:15096040 123..124
Epoxide hydrolase 235..555 62/313 (20%)
Abhydrolase_1 259..531 CDD:395444 57/297 (19%)
Microbody targeting signal. /evidence=ECO:0000255 553..555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.