DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and ceeh-1

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_497268.1 Gene:ceeh-1 / 175239 WormBaseID:WBGene00019329 Length:404 Species:Caenorhabditis elegans


Alignment Length:285 Identity:63/285 - (22%)
Similarity:112/285 - (39%) Gaps:35/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YTGENPETSPPLLTYHGLFGSKQNWRGISKALVRKVSRKVYAIDVR--NHGESP-HSSVHNSKAM 105
            |.....:..|.:|..||......:||...|....|.  :..|||.|  |..:.| |...::...:
 Worm   131 YVQTGSDDKPLMLFIHGYPEFWYSWRFQLKEFADKY--RCVAIDQRGYNLSDKPKHVDNYSIDEL 193

  Fly   106 SEDLRLFMEQRSHPNAACMGHSMGGRSMMYFARKYPELVERLIVVDISPISVPRSTGEMTEIFDA 170
            :.|:|..:|...:..|..:.|..||.....||.:|||:|::||..:|     ||.......|:.:
 Worm   194 TGDIRDVIEGLGYDKAIVVAHDWGGLVAWQFAEQYPEMVDKLICCNI-----PRPGSFRKRIYTS 253

  Fly   171 MVSLDLSPSMSMSEGRKIAREKLLKATEDETVDFIM----LNLRKNP-------DTGAFSWACNA 224
            ......|..|...:..||. |.|..|.:.:.::...    :.::.|.       :...:|::.|.
 Worm   254 WSQFRKSWYMFFYQNEKIP-EMLCSADDMKMLELCFRAKEIGIQNNKNFTDEDLEAWKYSFSMNG 317

  Fly   225 ----HVLREFLTRFD--KYQSNLE-ELPPYTGPTTFICGTRSPYMRREQWPQIQKMFPNSEIHWL 282
                :.:..:...|:  |.|::|. |:     ||..|.||....:..|.............:..:
 Worm   318 ASFKYPINYYRNIFNAKKQQADLVLEM-----PTLIIWGTADGALDIEAAVDSLNTLKQGTMKKI 377

  Fly   283 D-AGHLVHFEKPQEFLTIVSEFLNR 306
            : |.|.|..::|:.....:.:|||:
 Worm   378 EGASHWVQQDEPEMVNEHIKKFLNK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 61/282 (22%)
Abhydrolase_5 54..>151 CDD:289465 29/99 (29%)
Abhydrolase <253..287 CDD:304388 5/34 (15%)
ceeh-1NP_497268.1 MhpC 119..400 CDD:223669 60/281 (21%)
Abhydrolase 128..>257 CDD:304388 35/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.