DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and Mest

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001239221.1 Gene:Mest / 17294 MGIID:96968 Length:342 Species:Mus musculus


Alignment Length:308 Identity:63/308 - (20%)
Similarity:108/308 - (35%) Gaps:96/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SPPLLT-YHGLFGSKQNWRGISKALVRKVSRKVYAIDVRNHGES----PHS-SVHNSKAMSEDL- 109
            ||.::. .||...|..:|..|.:.|..:..| |.|:|....|.|    ||. |:....::.|.| 
Mouse    75 SPEIVVLLHGFPTSSYDWYKIWEGLTLRFHR-VIALDFLGFGFSDKPRPHQYSIFEQASIVESLL 138

  Fly   110 -RLFMEQRSHPNAACMGHSMG---GRSMMYFARKYPELVERLIVVDISPISVPRSTGEMTEIFDA 170
             .|.::.|   ....:.|..|   .:.::|   :|.:                ..:|.:|     
Mouse   139 RHLGLQNR---RINLLSHDYGDIVAQELLY---RYKQ----------------NRSGRLT----- 176

  Fly   171 MVSLDLSPSMSMSEG-------RKIAREKLLK------ATEDETVDFIMLNLRKNPDTGAFS--- 219
                  ..|:.:|.|       |.:..:||||      ......::|.:.:....|..|.::   
Mouse   177 ------IKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPT 235

  Fly   220 -------WACNAHVLR------------EFLTRFDKYQSN-LEELPPYTGPTTFICGTRSPYMRR 264
                   ||    |:|            :::.:..|::.. :..|...:.|..||.|...|.   
Mouse   236 ESELWDMWA----VIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPI--- 293

  Fly   265 EQWPQI----QKMFPNSEIHWLDAGHLVHF---EKPQEFLTIVSEFLN 305
            ..:|:.    :|..|.|.:..|| .|:.|:   |.|..||.....|:|
Mouse   294 NPYPEFLELYRKTLPRSTVSILD-DHISHYPQLEDPMGFLNAYMGFIN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 62/306 (20%)
Abhydrolase_5 54..>151 CDD:289465 23/107 (21%)
Abhydrolase <253..287 CDD:304388 10/37 (27%)
MestNP_001239221.1 MhpC 54..328 CDD:223669 58/294 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1268438at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.