DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and lid-1

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001348662.1 Gene:lid-1 / 172888 WormBaseID:WBGene00007711 Length:365 Species:Caenorhabditis elegans


Alignment Length:278 Identity:66/278 - (23%)
Similarity:96/278 - (34%) Gaps:92/278 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VYAIDVRNHGESPHSSVHNSKAMS--------EDLRLFMEQRSHPNAACMGHSMGGRSMMYFARK 139
            |::.|....|.|..|...:..|::        ||.|..|   .......:||:.||.....:|.:
 Worm   100 VHSFDPLGFGRSSRSRFSDDNAIAELEMVEVMEDWRKAM---GIEKMYIIGHAFGGYLASAYALE 161

  Fly   140 YPELVERLIVVDISPISVPRSTGEMTEIFDAMVS-LDLSPS--MSMSEG---------------- 185
            .|..|..||:||      |....|..|..:.:.: |.:.|.  ||...|                
 Worm   162 NPSRVAHLILVD------PWGFAEKVETTEKLNTWLQIKPYAWMSFLGGVAGYFNPFSPMRWMGP 220

  Fly   186 ------RKIAREKLLKATEDETVDF----IMLNLRKNPDTG--AF-------SWACNAHVLREFL 231
                  :|:..:.||:.......|.    ..||| .|| ||  ||       .||     .|..:
 Worm   221 YAPAIVKKLRPDLLLRFPGLHDYDIYKYVYYLNL-PNP-TGETAFMNMTLPVGWA-----KRPMI 278

  Fly   232 TRFDKYQSNLEELPPYTGPTTFICGTRSPYMRREQW----P--QIQKMFPNSEIHWLD------A 284
            .||:....|:        ..:||.|::|       |    |  .||....|:   ::|      |
 Worm   279 KRFNGIDKNV--------GVSFIYGSKS-------WIDPGPAIDIQSTRENA---YVDIKIVRGA 325

  Fly   285 GHLVHFEKPQEFLTIVSE 302
            |..|:.:.|..|..|||:
 Worm   326 GTHVYADDPAAFNEIVSD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 66/278 (24%)
Abhydrolase_5 54..>151 CDD:289465 19/75 (25%)
Abhydrolase <253..287 CDD:304388 12/45 (27%)
lid-1NP_001348662.1 PLN02894 <58..360 CDD:215484 66/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.