DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and abhd10

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001354732.1 Gene:abhd10 / 100135182 XenbaseID:XB-GENE-994024 Length:290 Species:Xenopus tropicalis


Alignment Length:151 Identity:34/151 - (22%)
Similarity:60/151 - (39%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KILRTQLVVRREYSS-------EIPDPVELSFDSYTGENPETSPPLLTYHGLFGSKQN------W 68
            |::..:|.|.|..|:       ::|   :|::....|:    ||.::...| |.|..|      .
 Frog    25 KVIVPRLAVCRLKSTLQYLTRQDLP---KLAYQKLKGK----SPGVIFLPG-FASDMNAQKAVAL 81

  Fly    69 RGISKALVRKVSRKVYAIDVRNHGESPHSSVHNSKAMSEDLRLFMEQRSHPNAACMGHSMGGRSM 133
            ....|:|.....|..|.....:.|:....::...|   :|:...::..:......:|.||||..|
 Frog    82 EEFCKSLGHSFIRFDYTGSGSSEGDFTECTIGGWK---KDVLHVLDSLAEGPQILVGSSMGGWLM 143

  Fly   134 MYFARKYPELVERLIVVDISP 154
            :..|...||.:..|  |.|:|
 Frog   144 LLAAIARPEKIAAL--VGIAP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 28/123 (23%)
Abhydrolase_5 54..>151 CDD:289465 21/102 (21%)
Abhydrolase <253..287 CDD:304388
abhd10NP_001354732.1 MhpC 50..262 CDD:223669 28/123 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.