DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2059 and serhl2

DIOPT Version :9

Sequence 1:NP_001188553.1 Gene:CG2059 / 31663 FlyBaseID:FBgn0029942 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001096280.2 Gene:serhl2 / 100124846 XenbaseID:XB-GENE-943365 Length:304 Species:Xenopus tropicalis


Alignment Length:313 Identity:69/313 - (22%)
Similarity:116/313 - (37%) Gaps:69/313 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELSFDSYTGE------NPETSPPLLTYHGLFGSKQNWRGISKALVRKV-----SRKVYAIDVRNH 91
            ||.|....|:      .|....|:|..||       |...:....|.:     .....|:|...|
 Frog     7 ELRFTVPWGQLAAKAWGPSDGRPVLCLHG-------WLDNANTFDRLIPLLPNDHHFVALDFSGH 64

  Fly    92 GESPHSSVHNSKAMSE-----------DLRLFMEQRSHPNAACMGHSMGGRSMMYFARKYPELVE 145
            |.|.|        |.|           |:...:.|......:.|||||||.....||..:|:||:
 Frog    65 GLSSH--------MPEGVRYQHVDYVSDVHRVVTQLGWRQFSIMGHSMGGVVGGLFASVFPKLVK 121

  Fly   146 RLIVVD---ISPISVPRSTGEMTEIFDAMVSLDLSPSMSMSEGR----KIAREKLLKATEDETVD 203
            .||::|   ..|::.......:.:|......|:     .:|.|:    :.|.::||:|....|.:
 Frog   122 NLILLDSYGFFPVNADMIQTHLKKIISYYSRLE-----GVSAGKIYSPEGALQRLLEANVSLTQE 181

  Fly   204 FIMLNLRKNPDT--GAFSWACNAHV---------LREFLTRFDKYQSNLEELPPYTGPTTFICGT 257
            ...|.|.:...|  |...::.:..|         ..:.:....|.|:::..:....|.|..:  .
 Frog   182 TAKLLLERGTKTVEGGVVFSRDIRVTVNNSLPLSTEQCVLMLSKIQADVHIIMANEGLTADM--M 244

  Fly   258 RSPYMRREQWPQIQKMFPNS-----EIHWLDAGHLVHFEKPQEFLTIVSEFLN 305
            |..|....|  .:.|.|..|     ::..:|..|.||..:|::...|:::||:
 Frog   245 RGVYTDVGQ--ALLKGFRESLKERCQVTVVDGNHFVHLNEPEKVAGIINDFLH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2059NP_001188553.1 PRK10673 38..305 CDD:182637 68/311 (22%)
Abhydrolase_5 54..>151 CDD:289465 30/112 (27%)
Abhydrolase <253..287 CDD:304388 7/38 (18%)
serhl2NP_001096280.2 MhpC 16..297 CDD:223669 65/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.