DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9650 and ZNF708

DIOPT Version :9

Sequence 1:NP_001356899.1 Gene:CG9650 / 31660 FlyBaseID:FBgn0029939 Length:1254 Species:Drosophila melanogaster
Sequence 2:XP_016882693.1 Gene:ZNF708 / 7562 HGNCID:12945 Length:587 Species:Homo sapiens


Alignment Length:401 Identity:90/401 - (22%)
Similarity:127/401 - (31%) Gaps:153/401 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 QEPIAHC----YSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHRSP 770
            |..|.|.    |.|..|.|.|:..:||..|:..|||||||||..|....:....|.:|..:|.. 
Human   185 QHEIIHTGEKPYKCEECGKAFKKSSNLTNHKIIHTGEKPYKCEECGKAFNQSSTLTRHKIIHTG- 248

  Fly   771 ADDQDNQDNQDDGSNADSLETNEADNDEDPNPDESEEELGDGDNDPDGDGDLDGEDEDEDELEEC 835
                                                                       ::|.:|
Human   249 -----------------------------------------------------------EKLYKC 254

  Fly   836 EDMDYKAEDLSVSNRIDGKSQSPKTTSSGATSLVGELMDKFGLSNIAQYSEAYKQALQESGRKEA 900
            |:.              ||:                    |..|     |...|..:..:|.|..
Human   255 EEC--------------GKA--------------------FNRS-----SNLTKHKIVHTGEKPY 280

  Fly   901 AAAAAAAAAAADNNNRGGAGAPLSDKLNGLPVAALRLRDEFAKNCNMFQQPQDGGAPSQVPLFNP 965
            .......|....:|        |::.                |..:..::|...|...:.     
Human   281 KCEECGKAFKQSSN--------LTNH----------------KKIHTGEKPYKCGECGKA----- 316

  Fly   966 FPNPFELSKRMKMDGGDWWGMSQALHRNEALFENLKLKPLGLGGA--NSLIQGPLLKKESRQRND 1028
                |.||..:.        ..:.:|..|..:   |.:..|...:  ::|.:..::..|.:... 
Human   317 ----FTLSSHLT--------THKRIHTGEKPY---KCEECGKAFSVFSTLTKHKIIHTEEKPYK- 365

  Fly  1029 TCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHGRTGKDVYRCRFCDM 1093
             ||.|||.|...|:||.|:..||||||||||.|..|..:||.||.|...|  |||..|:|..|..
Human   366 -CEECGKAFNRSSHLTNHKVIHTGEKPYKCEECGKAFTKSSTLTYHKVIH--TGKKPYKCEECGK 427

  Fly  1094 PFSVPSTLEKH 1104
            .||:.|.|.||
Human   428 AFSIFSILTKH 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9650NP_001356899.1 zf-C2H2 717..739 CDD:333835 8/21 (38%)
C2H2 Zn finger 719..739 CDD:275368 7/19 (37%)
zf-H2C2_2 731..756 CDD:338759 13/24 (54%)
C2H2 Zn finger 747..767 CDD:275368 4/19 (21%)
zf-C2H2 1029..1050 CDD:333835 10/20 (50%)
C2H2 Zn finger 1030..1050 CDD:275368 10/19 (53%)
zf-H2C2_2 1042..1067 CDD:338759 15/24 (63%)
C2H2 Zn finger 1058..1078 CDD:275368 9/19 (47%)
C2H2 Zn finger 1088..1106 CDD:275368 8/17 (47%)
ZNF708XP_016882693.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.