DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9650 and Zfp219

DIOPT Version :9

Sequence 1:NP_001356899.1 Gene:CG9650 / 31660 FlyBaseID:FBgn0029939 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_001240623.1 Gene:Zfp219 / 69890 MGIID:1917140 Length:726 Species:Mus musculus


Alignment Length:566 Identity:119/566 - (21%)
Similarity:178/566 - (31%) Gaps:160/566 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 GTTSPGAGST----------------------VNS-------SSPSPRQKQSPHFASPSPSQQQQ 658
            |..|||.|:.                      .||       :.|..:..|.||....:   .|:
Mouse    40 GPGSPGMGAVGWSETRAGERRFPCPVCGKRFRFNSILALHLRAHPGAQAFQCPHCGHRA---AQR 101

  Fly   659 QQLATIPRPHSLTPPE-------------------KLGDASSENGSLGLILASTPRSASTPPSKT 704
            ..|.:..|.|....|.                   :||.|.|..|            ..:.|:..
Mouse   102 ALLRSHLRTHQPERPRSPAARLLLELEERALLREARLGRARSSGG------------MQSSPAAE 154

  Fly   705 GDVSLQEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKH-MRVHR 768
            |....|.|.:..:.|.:|..|||.......|  .|...:|:||:.|.|..|..::|:.| :..| 
Mouse   155 GLARPQVPSSSAFRCPFCKGKFRTSAERERH--LHILHRPWKCSLCSFGSSQEEELLHHSLTAH- 216

  Fly   769 SPADDQDNQDNQDDGSNADSLETNEADNDEDPNPDESE-----EELGDGDNDPDGDGDLDGEDED 828
                          |::...|..  ....|.|.|.:.|     |...:.:..|:.|.:.:.....
Mouse   217 --------------GASERPLAA--TSTPEPPPPPQQEPRSALEPEPEPEPRPEPDREANPAPTP 265

  Fly   829 EDELEECEDMDYK----AEDLSVSNRIDGKSQSPKTTSSGATSLVGE-LMDKFGLSNIAQYSEAY 888
            ....|.....:::    .:..:.|..:.|..:..|.:...|..:.|. ..:.:.|.|..:...:.
Mouse   266 APPEEPPAPPEFRCQVCGQSFTQSWFLKGHMRKHKASFDHACPVCGRCFKEPWFLKNHMKVHTSK 330

  Fly   889 KQALQESGRKEAAAAA--------------------AAAAAAADNNNRGGAGAPLSDKLNGLPVA 933
            ...|:..|...|.|.|                    |.|.|.|:...      |.| .|..|.|.
Mouse   331 LGPLRAPGPGSAPARAPQPPDLSLLAYEPLGPALLLAPAPAPAERRE------PPS-LLGYLSVR 388

  Fly   934 ALRLRDEFAKNCNMFQQPQDGGAPSQVPLFNPFPN-------------PFELSKRMKMDGGDW-- 983
            |..:|..        .:..|.|.......|.|.|:             |.|..:.::.:...|  
Mouse   389 AGEVRPN--------GEGADPGGGRSYGGFRPLPSALPNRARRHRTEEPEEEEEVVEAEEESWAR 445

  Fly   984 ---WGMSQALHRNEALFENLKLKPLGLGGA----------NSLIQGPLLKKESR-QRNDTCEFCG 1034
               .|...:||.|......   :|....|.          |.|:.|....:..| .....|.|||
Mouse   446 GRSLGSLTSLHPNPGEGSG---QPAPAAGTQARSTATQEENGLLVGGTRSEAGRGATGKDCPFCG 507

  Fly  1035 KVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHGR 1080
            |.|::..:|.||.|.||||:||||..|.||..||..|..|::.|.|
Mouse   508 KSFRSAHHLKVHLRVHTGERPYKCPHCDYAGTQSGSLKYHLQRHHR 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9650NP_001356899.1 zf-C2H2 717..739 CDD:333835 6/21 (29%)
C2H2 Zn finger 719..739 CDD:275368 6/19 (32%)
zf-H2C2_2 731..756 CDD:338759 7/24 (29%)
C2H2 Zn finger 747..767 CDD:275368 6/20 (30%)
zf-C2H2 1029..1050 CDD:333835 10/20 (50%)
C2H2 Zn finger 1030..1050 CDD:275368 10/19 (53%)
zf-H2C2_2 1042..1067 CDD:338759 15/24 (63%)
C2H2 Zn finger 1058..1078 CDD:275368 8/19 (42%)
C2H2 Zn finger 1088..1106 CDD:275368
Zfp219NP_001240623.1 C2H2 Zn finger 63..83 CDD:275368 2/19 (11%)
C2H2 Zn finger 91..111 CDD:275368 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..164 8/36 (22%)
C2H2 Zn finger 169..187 CDD:275368 6/19 (32%)
C2H2 Zn finger 195..211 CDD:275368 5/15 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..278 9/61 (15%)
zf-C2H2 277..299 CDD:395048 2/21 (10%)
C2H2 Zn finger 279..299 CDD:275368 2/19 (11%)
zf-C2H2 305..327 CDD:395048 4/21 (19%)
C2H2 Zn finger 307..327 CDD:275368 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..498 19/117 (16%)
C2H2 Zn finger 503..523 CDD:275368 10/19 (53%)
zf-C2H2 503..523 CDD:395048 10/19 (53%)
zf-H2C2_2 515..537 CDD:404364 13/21 (62%)
zf-H2C2_5 529..552 CDD:404746 10/22 (45%)
C2H2 Zn finger 531..551 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..645 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 674..726
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.