DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9650 and ken

DIOPT Version :9

Sequence 1:NP_001356899.1 Gene:CG9650 / 31660 FlyBaseID:FBgn0029939 Length:1254 Species:Drosophila melanogaster
Sequence 2:NP_523833.1 Gene:ken / 37785 FlyBaseID:FBgn0011236 Length:601 Species:Drosophila melanogaster


Alignment Length:476 Identity:100/476 - (21%)
Similarity:150/476 - (31%) Gaps:164/476 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   768 RSPADDQDNQDNQDDGSNADSLETNEADN-DEDPNPDESEEELGDGDN-----DPDGDGDLDGED 826
            |..||.:..|.........|.....|.|: ||..|..:........||     :.:..|..:.::
  Fly   137 RDRADRRKQQYTSPQNLEPDQTLKYEVDSVDESRNAADFSSAFNSNDNCESAAECERSGGHNNKE 201

  Fly   827 EDEDELEECEDMDYKAEDLSVSNRIDGKSQSPKTTSSGATSLVGELMDKFGLSNIAQYSEAYKQ- 890
            ||||   :|...|.|::  ..::.|...|.:|.:.:||:.            |||:..|...:| 
  Fly   202 EDED---DCTHKDNKSD--KDTDEIVNLSNAPPSGTSGSN------------SNISTSSNHQQQQ 249

  Fly   891 ------------------------------ALQESGRKEAAAAAA-----------AAAAAADNN 914
                                          :|....:.|.:|:..           .|..|:::.
  Fly   250 HHHHHHHNHNNNNNNNNNNSSSSTINPVNLSLDLRTKSENSASRTLGSGSDHSGIDLAVTASEST 314

  Fly   915 NRGG--------AGAPLSD--KLNGLP--------------------------------VAALRL 937
            .|.|        ...||||  .:|..|                                :..|||
  Fly   315 KRKGLFFDSHKDVMKPLSDGSDINSSPENYVVTPHRKRRPGFHNTQSDNQPFTSYPHSLLEELRL 379

  Fly   938 RDE-------FAKNCNMFQQPQDGG------APSQVPLFNPFPNPFELSKRMKMDGGDWWGMSQA 989
            ...       |....||....:||.      .|.:..|.....|..: |..:.|..|..:.....
  Fly   380 AKSTTSPISGFGSEKNMLAHLEDGALNGDTLTPDRKHLLEAQRNRAQ-SPEIPMHLGPQFVYQWQ 443

  Fly   990 LHRNEAL--FENLKLK-------------PLG-----------LGGANSLIQGPLLKKESRQRND 1028
            .::|.|:  ..||:.:             |.|           |.|:|:        ..|..|..
  Fly   444 SNQNAAMSAMPNLQSRLSSLSHISLNLDHPEGRSGSASGSGANLAGSNT--------HASSVREY 500

  Fly  1029 TCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHM---------KTHGRTGKD 1084
            .||:|||.|....||..|.|.||||||:.|.||.....|.:.|.:|:         .|:|...::
  Fly   501 RCEYCGKQFGMSWNLKTHLRVHTGEKPFACRLCVAMFKQKAHLLKHLCSVHRNVITTTNGADTEN 565

  Fly  1085 VYRCRFCDMPFSVPSTLEKHM 1105
            .|.|.||.|.|.....|.:|:
  Fly   566 RYSCCFCSMCFESVQELVRHL 586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9650NP_001356899.1 zf-C2H2 717..739 CDD:333835
C2H2 Zn finger 719..739 CDD:275368
zf-H2C2_2 731..756 CDD:338759
C2H2 Zn finger 747..767 CDD:275368
zf-C2H2 1029..1050 CDD:333835 10/20 (50%)
C2H2 Zn finger 1030..1050 CDD:275368 10/19 (53%)
zf-H2C2_2 1042..1067 CDD:338759 13/24 (54%)
C2H2 Zn finger 1058..1078 CDD:275368 6/28 (21%)
C2H2 Zn finger 1088..1106 CDD:275368 7/18 (39%)
kenNP_523833.1 BTB 27..>107 CDD:279045
BTB 34..>107 CDD:197585
zf-C2H2 500..522 CDD:278523 10/21 (48%)
C2H2 Zn finger 502..522 CDD:275368 10/19 (53%)
zf-H2C2_2 514..539 CDD:290200 13/24 (54%)
C2H2 Zn finger 530..551 CDD:275368 6/20 (30%)
C2H2 Zn finger 569..589 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45993
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.