DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9650 and Zfp296

DIOPT Version :9

Sequence 1:NP_001356899.1 Gene:CG9650 / 31660 FlyBaseID:FBgn0029939 Length:1254 Species:Drosophila melanogaster
Sequence 2:XP_345066.3 Gene:Zfp296 / 365511 RGDID:1595818 Length:449 Species:Rattus norvegicus


Alignment Length:460 Identity:117/460 - (25%)
Similarity:155/460 - (33%) Gaps:195/460 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   657 QQQQLATIPRPHSLTPPEKLGDASSENGSLGLILASTPRSA--------STPPSKTGDVSLQEPI 713
            |.|||.|...|                 .|||...:...||        ..||| ....:.:.| 
  Rat   170 QTQQLETPEAP-----------------LLGLAEVAAAMSAVAVVGPVEDKPPS-VSSAARRSP- 215

  Fly   714 AHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHRSPADDQDNQD 778
                :|..|.|.....:||.:|.|:||||:||.|..|.:.|:...||.:|.:.||.|.       
  Rat   216 ----TCFVCKKTLSSFSNLKVHMRSHTGERPYSCDQCSYSCAQSSKLNRHKKTHRQPT------- 269

  Fly   779 NQDDGSNADSLETNEADNDEDPNPDESEEELGDGDNDPDGDGDLDGEDEDEDELEECEDMDYKAE 843
               .||.:.|..:.|......|.|                                         
  Rat   270 ---PGSPSTSASSREVSPAAPPEP----------------------------------------- 290

  Fly   844 DLSVSNRIDGKSQSPKTTSSGATSLVGELMDKFGLSNIAQYSEAYKQALQESGRKEAAAAAAAAA 908
                                                                   .|.|||.|:.
  Rat   291 -------------------------------------------------------AAYAAAPAST 300

  Fly   909 AAADNNNRGGAGAPLSDKLNGLPVAALRLRDEFAKNCNMFQQPQDGGAPSQVPLFNPFPNPFELS 973
            ....|..:.||.|....:..|.|.:..:            :.|..||..:...:        |.:
  Rat   301 PPCQNVEKAGAAATAGIQEPGAPGSGAQ------------ESPGFGGCGATAKV--------ERT 345

  Fly   974 KRMKMDGGDWWGMSQALHRNEALFENLKLKPLGLGGANSLIQGPLLKKESRQRNDTCEFCGKVFK 1038
            ..:||:                     |..|                ::|.:....||||||.|.
  Rat   346 DSVKME---------------------KTTP----------------RKSHRAGGKCEFCGKSFT 373

  Fly  1039 NCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHG-RTGKDVYRCRFCDMPFSVPSTLE 1102
            |.|||||||||||||:||.|:.|||||||||||.||.:||| .|||.||:|..|.:||.:.:||:
  Rat   374 NSSNLTVHRRSHTGERPYTCDQCSYACAQSSKLNRHRRTHGLGTGKTVYKCPHCLVPFVLQATLD 438

  Fly  1103 KHMRK 1107
            ||:|:
  Rat   439 KHLRQ 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9650NP_001356899.1 zf-C2H2 717..739 CDD:333835 7/21 (33%)
C2H2 Zn finger 719..739 CDD:275368 7/19 (37%)
zf-H2C2_2 731..756 CDD:338759 13/24 (54%)
C2H2 Zn finger 747..767 CDD:275368 6/19 (32%)
zf-C2H2 1029..1050 CDD:333835 16/20 (80%)
C2H2 Zn finger 1030..1050 CDD:275368 16/19 (84%)
zf-H2C2_2 1042..1067 CDD:338759 20/24 (83%)
C2H2 Zn finger 1058..1078 CDD:275368 14/19 (74%)
C2H2 Zn finger 1088..1106 CDD:275368 8/17 (47%)
Zfp296XP_345066.3 C2H2 Zn finger 217..237 CDD:275370 7/19 (37%)
zf-H2C2_2 229..254 CDD:290200 13/24 (54%)
C2H2 Zn finger 245..265 CDD:275370 6/19 (32%)
COG5048 344..>413 CDD:227381 42/105 (40%)
zf-C2H2 364..385 CDD:278523 16/20 (80%)
C2H2 Zn finger 365..385 CDD:275368 16/19 (84%)
zf-H2C2_2 377..402 CDD:290200 20/24 (83%)
C2H2 Zn finger 393..413 CDD:275368 14/19 (74%)
C2H2 Zn finger 424..442 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45993
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.