DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment fz4 and MFRP

DIOPT Version :9

Sequence 1:	NP_511068.2	Gene:	fz4 / 31659	FlyBaseID:	FBgn0027342	Length:	705	Species:	Drosophila melanogaster
Sequence 2:	NP_113621.1	Gene:	MFRP / 83552	HGNCID:	18121	Length:	579	Species:	Homo sapiens

Alignment Length:	133	Identity:	44/133 - (33%)
Similarity:	64/133 - (48%)	Gaps:	10/133 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 KSSTSG-NPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNL-VGNEMQTDVEYTLQTF 83
            :..|.| :.:.|.....|||:    .||.:::|||..:.||.|:.||: ||...|.:|...|..:
Human   444 RDCTDGSDDNCSGPLFPPPEL----ACEPVQVEMCLGLSYNTTAFPNIWVGMITQEEVVEVLSGY 504

  Fly    84 APLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCD 148
            ..|....|....:..||...||.|||...|  :.||||:|:....:|...|...|.|||  .:|:
Human   505 KSLTSLPCYQHFRRLLCGLLVPRCTPLGSV--LPPCRSVCQEAEHQCQSGLALLGTPWP--FNCN 565

  Fly   149 KFP 151
            :.|
Human   566 RLP 568

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
fz4	NP_511068.2	CRD_FZ4	43..169	CDD:143557	38/110 (35%)
fz4	NP_511068.2	7tm_4	223..544	CDD:304433
MFRP	NP_113621.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	100..143
		CUB	144..252	CDD:238001
		LDLa	260..294	CDD:238060
		CUB	301..411	CDD:238001
		LDLa	421..454	CDD:238060	2/9 (22%)
		Fz	466..569	CDD:279700	38/107 (36%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3577
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810