DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and szl

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001037971.1 Gene:szl / 733750 XenbaseID:XB-GENE-482077 Length:281 Species:Xenopus tropicalis


Alignment Length:146 Identity:50/146 - (34%)
Similarity:76/146 - (52%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QCETI--RIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMC 107
            :|.:|  .:.||..|||:|..:|||:|:....:|......:..|::..|....::|||:.:.|:|
 Frog    26 KCVSIPKEMAMCNDIGYSEMRLPNLMGHTSMAEVVPKSAEWQNLLQTGCHPYARMFLCSLFAPVC 90

  Fly   108 TPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQ 172
            ...    .|.||||:|.:||..|.|||...|..||.:||||:||.   .|.||::...:.:|...
 Frog    91 LDT----FIQPCRSMCVAVRDSCAPVLACHGHAWPESLDCDRFPA---GEDMCLDTLSKEYQYSY 148

  Fly   173 EQDLYGLPG---QGIP 185
            ::    ||.   ||.|
 Frog   149 KE----LPKPSCQGCP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 44/125 (35%)
7tm_4 223..544 CDD:304433
szlNP_001037971.1 CRD_sizzled 19..159 CDD:143561 48/143 (34%)
NTR_Sfrp1_like 153..281 CDD:239635 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.