DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and sfrp2

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001070852.2 Gene:sfrp2 / 566878 ZFINID:ZDB-GENE-061013-293 Length:294 Species:Danio rerio


Alignment Length:133 Identity:50/133 - (37%)
Similarity:74/133 - (55%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PEIPAFRQ---CETI--RIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKL 97
            ||:  |::   |:.|  .:.:|..|.|....:|||:|:|...:|.....::.||::..|....|.
Zfish    29 PEL--FQKKSNCKPIPTNLLLCHDIEYTNMRLPNLLGHETMNEVLQQASSWTPLVQKQCHPDTKK 91

  Fly    98 FLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCME 162
            |||:.:.|:|..... ..|.|||||||||:..|.||:..||||||..|||.:||.:|:   :|:.
Zfish    92 FLCSLFAPVCLDDLD-EPIQPCRSLCESVKSGCAPVMAAFGFPWPDMLDCRRFPLDND---LCIP 152

  Fly   163 GPG 165
            ..|
Zfish   153 PAG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 48/128 (38%)
7tm_4 223..544 CDD:304433
sfrp2NP_001070852.2 CRD_SFRP2 34..161 CDD:143555 47/126 (37%)
NTR_Sfrp1_like 167..294 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.