DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and col18a1a

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_021334395.1 Gene:col18a1a / 564123 ZFINID:ZDB-GENE-030516-3 Length:1645 Species:Danio rerio


Alignment Length:149 Identity:36/149 - (24%)
Similarity:57/149 - (38%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SKSSTSGNPSASSSSSSPPEIPAFRQCETIR-------IEMCRKIGYNETSMPNLVGNEMQTDVE 77
            |:.:.|.|.....|......:||  ..|.:|       :..|.:.|....|:||.:......:|.
Zfish   178 SEYAVSDNALTIESQFLIASMPA--SFEPLRCLPVDSGLPFCTRRGVESFSVPNFLNQSSVEEVR 240

  Fly    78 YTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWP 142
            ..|..:|.|:...|...|:.|.|....|.|....   ::.||||.||.::..|..:|.....|  
Zfish   241 MVLTEWAWLLRSGCHHSLEWFFCLLLTPRCGHSG---SLLPCRSSCEVLQDSCWTLLDEGRLP-- 300

  Fly   143 PALDCDKFPRENNHETMCM 161
              ::|...|.|.:....|:
Zfish   301 --VECKSLPEEKHDGYRCL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 30/126 (24%)
7tm_4 223..544 CDD:304433
col18a1aXP_021334395.1 CRD_Collagen_XVIII 203..340 CDD:143564 30/122 (25%)
LamG 327..516 CDD:328935
Collagen 816..860 CDD:189968
Collagen <937..980 CDD:189968
Collagen 959..1055 CDD:189968
Endostatin 1471..1639 CDD:310825
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.