DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and fzd7

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001016741.1 Gene:fzd7 / 549495 XenbaseID:XB-GENE-483731 Length:548 Species:Xenopus tropicalis


Alignment Length:601 Identity:161/601 - (26%)
Similarity:248/601 - (41%) Gaps:115/601 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVVILLHPRISKSSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNEMQ 73
            ||..:||.|..|.....|....|        :|....|:.|.|.:|..|.||:|.||||:|:..|
 Frog     7 LLFCLLLQPSPSAQQYHGEKGIS--------VPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQ 63

  Fly    74 TDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFG 138
            .|....:..|.||::..||.:|:.|||:.|.|:||  ....||.|||||||..|..|..::..||
 Frog    64 EDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT--VLEQAIPPCRSLCERARQGCEALMNKFG 126

  Fly   139 FPWPPALDCDKFPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGK----LP------ 193
            |.||..|.|:.||         :.|.||:...|...|       ..|.|...:    ||      
 Frog   127 FQWPERLRCENFP---------IHGAGEICVGQNTSD-------NSPSGPTARPTPYLPDSITFH 175

  Fly   194 ------MDCSGLAK--SHLYVRLPRSGRCAPLCEAD-----ILFTPAEKHLAEIWVSTWAYAALG 245
                  ..|....|  .:|..|......|...||..     :.|...|...|.:||..||... |
 Frog   176 PHLNRDFTCPRQLKVPPYLGYRFLGEKDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILC-G 239

  Fly   246 LALVATVCLLASDGSRLASAKWSRLLSPLIW---CHNMVTLGWAVRFMVGRTGTACGTDPQAPNE 307
            ::.:.||.....|..|.:..:     .|:|:   |:.||.:.:...|::...|...   .:...:
 Frog   240 ISTLFTVLTYLVDMRRFSYPE-----RPIIFLSGCYFMVAVAYTAGFLLEERGVCV---ERFSED 296

  Fly   308 SLLTV-DGLSNASCASVFLMRYYFGMAACAWWAVLCLGWHRDIRRHSPDSK-GHVVIPSNFGGSP 370
            |..|| .|.....|..:|::.|:||||:..||.:|.|.|..     :...| ||..|.:|     
 Frog   297 SYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFL-----AAGMKWGHEAIEAN----- 351

  Fly   371 AKRNSAKTAQQDLTQNNFVCFVAWGLPAFQTSAVIVARFVDADELLGACFVGNQSDKALQILVAT 435
                           :.:....||.:||.:|..::....||.|.|.|.|:||..|..:|:..|..
 Frog   352 ---------------SQYFHLAAWAVPAVKTITILAMGQVDGDILSGVCYVGINSVDSLRGFVLA 401

  Fly   436 PVFCYWIFGSMNLISGYLVHCRTKEILRNSNALSVQQQLQQLSAHSSSGIGIFLFIYGLACAMLL 500
            |:|.|...|:..|::|::...|.:.|:::....:  ::|::|...    ||:|..:|.:...::|
 Frog   402 PLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKT--EKLEKLMVR----IGVFSVMYTVPATIVL 460

  Fly   501 LAVIYEFANIDVWLGSGDTNT--------------PLWP----FLLRAFMELMLGICCFAWVLGP 547
            ....||.|..|.|..:....|              |:.|    |:::..|.:::||....|:...
 Frog   461 ACYFYEQAFRDTWEKTWLVQTCKGFAVPCPNYNFAPMSPDFTVFMIKYLMTMIVGITSSFWIWSG 525

  Fly   548 SISTLYKR---QVSNG 560
            .....::|   ::|||
 Frog   526 KTLQSWRRFYHRLSNG 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 51/125 (41%)
7tm_4 223..544 CDD:304433 83/343 (24%)
fzd7NP_001016741.1 CRD_FZ7 32..156 CDD:143575 53/141 (38%)
Frizzled 218..536 CDD:279827 85/357 (24%)
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 526..531 0/4 (0%)
PDZ-binding. /evidence=ECO:0000255 546..548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.