Sequence 1: | NP_511068.2 | Gene: | fz4 / 31659 | FlyBaseID: | FBgn0027342 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058565.2 | Gene: | Corin / 53419 | MGIID: | 1349451 | Length: | 1113 | Species: | Mus musculus |
Alignment Length: | 195 | Identity: | 58/195 - (29%) |
---|---|---|---|
Similarity: | 81/195 - (41%) | Gaps: | 35/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 SSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTD--VEYTLQTFA 84
Fly 85 PLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDK 149
Fly 150 FPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRC 214
Fly 215 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz4 | NP_511068.2 | CRD_FZ4 | 43..169 | CDD:143557 | 42/127 (33%) |
7tm_4 | 223..544 | CDD:304433 | |||
Corin | NP_058565.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..202 | ||
CRD_corin_1 | 202..331 | CDD:143554 | |||
LDLa | 337..372 | CDD:238060 | |||
LDLa | 374..408 | CDD:238060 | |||
Ldl_recept_a | 415..445 | CDD:278486 | |||
LDLa | 455..482 | CDD:238060 | |||
CRD_corin_2 | 522..643 | CDD:143579 | 44/138 (32%) | ||
Ldl_recept_a | 648..682 | CDD:278486 | 9/19 (47%) | ||
LDLa | <695..720 | CDD:238060 | |||
LDLa | 723..757 | CDD:238060 | |||
SR | 758..853 | CDD:214555 | |||
Tryp_SPc | 868..1097 | CDD:214473 | |||
Tryp_SPc | 869..1100 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |