DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and Corin

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_058565.2 Gene:Corin / 53419 MGIID:1349451 Length:1113 Species:Mus musculus


Alignment Length:195 Identity:58/195 - (29%)
Similarity:81/195 - (41%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTD--VEYTLQTFA 84
            ||...:.:.||...|...:....|||.|.:|:|..:.||.|..||.:|:..|.:  :.:....|.
Mouse   499 SSCVESCAGSSLCDSDSSLSNCSQCEPITLELCMNLPYNHTHYPNYLGHRTQKEASISWESSLFP 563

  Fly    85 PLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDK 149
            .|::.:|...|..|.|...||.|..... ..|.|||.|||..:.||..||...|..||...||::
Mouse   564 ALVQTNCYKYLMFFACTILVPKCDVNTG-QRIPPCRLLCEHSKERCESVLGIVGLQWPEDTDCNQ 627

  Fly   150 FPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRC 214
            ||.|::....|:                 ||.:.:.         :||   .||...   |||||
Mouse   628 FPEESSDNQTCL-----------------LPNEDVE---------ECS---PSHFKC---RSGRC 660

  Fly   215  214
            Mouse   661  660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 42/127 (33%)
7tm_4 223..544 CDD:304433
CorinNP_058565.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..202
CRD_corin_1 202..331 CDD:143554
LDLa 337..372 CDD:238060
LDLa 374..408 CDD:238060
Ldl_recept_a 415..445 CDD:278486
LDLa 455..482 CDD:238060
CRD_corin_2 522..643 CDD:143579 44/138 (32%)
Ldl_recept_a 648..682 CDD:278486 9/19 (47%)
LDLa <695..720 CDD:238060
LDLa 723..757 CDD:238060
SR 758..853 CDD:214555
Tryp_SPc 868..1097 CDD:214473
Tryp_SPc 869..1100 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.