DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and frzb

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001005438.1 Gene:frzb / 448021 XenbaseID:XB-GENE-481353 Length:319 Species:Xenopus tropicalis


Alignment Length:177 Identity:53/177 - (29%)
Similarity:80/177 - (45%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPK 110
            ||.:||.||:.:.:|.|.|||.:.:..|.:....::.|..|:..:||..|..||||.|.|:||..
 Frog    31 CEPVRIPMCKSMPWNMTKMPNHLHHSTQANAILAIEQFEGLLTTECSQDLLFFLCAMYAPICTID 95

  Fly   111 APVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQEQD 175
            .....|.||:|:||..|..|.|:|..:...||.:|.|::.|..:  ..:|: .|..:...:|..|
 Frog    96 FQHEPIKPCKSVCERARAGCEPILIKYRHTWPESLACEELPVYD--RGVCI-SPEAIITVEQGTD 157

  Fly   176 LYGLPGQGIPGGLGGKLPMD-----CSGLAKSHLYVRLPRSGRCAPL 217
              .:|          ..|||     |...|..|.        :|.|:
 Frog   158 --SMP----------DFPMDSNNGNCGSTAGEHC--------KCKPM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 42/122 (34%)
7tm_4 223..544 CDD:304433
frzbNP_001005438.1 CRD_SFRP3 28..153 CDD:143550 42/124 (34%)
NTR_Sfrp3_like 189..299 CDD:239636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.