DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and sfrp2

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_989062.1 Gene:sfrp2 / 394659 XenbaseID:XB-GENE-485147 Length:295 Species:Xenopus tropicalis


Alignment Length:158 Identity:55/158 - (34%)
Similarity:81/158 - (51%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CLLVVILLHPRISKSSTS----GNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLV 68
            |||:::||......|...    |.|..|...|:...|||       .:.:|..|.|....:|||:
 Frog     7 CLLLLVLLASDCMDSVRGLFPFGQPEFSYKRSNCKPIPA-------TLVLCHDIEYPNMRLPNLL 64

  Fly    69 GNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPV 133
            |:|...:|.....::.||::..|....|.|||:.:.|:|..... ..|.|||||||.|:..|.||
 Frog    65 GHETMKEVLQQASSWIPLVQKQCHQDTKKFLCSLFAPVCIDDLD-ETIKPCRSLCEQVKDSCAPV 128

  Fly   134 LQGFGFPWPPALDCDKFPRENNHETMCM 161
            :..||||||..|:|.:||::|:   :|:
 Frog   129 MSAFGFPWPDMLECSRFPQDND---LCI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 42/119 (35%)
7tm_4 223..544 CDD:304433
sfrp2NP_989062.1 CRD_SFRP2 36..163 CDD:143555 46/129 (36%)
NTR_Sfrp1_like 169..295 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.