DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and Mfrp

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001101607.1 Gene:Mfrp / 315597 RGDID:1307477 Length:590 Species:Rattus norvegicus


Alignment Length:107 Identity:36/107 - (33%)
Similarity:54/107 - (50%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CETIRIEMCRKIGYNETSMPNL-VGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTP 109
            ||.:::|||..:.||.|:.||: ||...|.:|...|:.:..|....|....:.|||....|.||.
  Rat   477 CEPVQVEMCLGLSYNTTAFPNIWVGLATQMEVTDILRGYKSLTSLPCYQTFRRFLCGLLEPRCTS 541

  Fly   110 KAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFP 151
            ...:  :.||||:|:....:|...|...|.|||  .:|::.|
  Rat   542 LGTI--LPPCRSVCQEAEQQCQSSLALLGIPWP--FNCNRLP 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 36/107 (34%)
7tm_4 223..544 CDD:304433
MfrpNP_001101607.1 CUB 150..258 CDD:238001
LDLa 266..300 CDD:238060
CUB 307..419 CDD:238001
Fz 477..579 CDD:279700 35/105 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.