DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and frzb

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_571018.1 Gene:frzb / 30119 ZFINID:ZDB-GENE-990715-1 Length:315 Species:Danio rerio


Alignment Length:210 Identity:63/210 - (30%)
Similarity:91/210 - (43%) Gaps:52/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CIL---CLLVVILLHPRISKSSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPN 66
            |:|   |||.:    ||       |..:||              ||.|||.||:.:.:|.|.|||
Zfish    12 CVLAFACLLEI----PR-------GTGAAS--------------CEPIRIPMCKSMPWNMTKMPN 51

  Fly    67 LVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCH 131
            .:.:..|.:....::.|..|:...||:.|..||||.|.|:||.......|.||:|:||..:..|.
Zfish    52 HLHHSTQANAVLAIEQFEGLLGTQCSADLLFFLCAMYAPICTIDFQHDPIKPCKSVCERAKCGCE 116

  Fly   132 PVLQGFGFPWPPALDCDKFPRENNHETMCM--------EGPGELHQPQQEQDLYGLPGQGIPGGL 188
            ||::.:...||.:|.|::.|..:  ..:|:        |||        :...|..|.:..|.| 
Zfish   117 PVMKRYNHTWPESLACEELPVYD--RGVCISPEAIVKAEGP--------DNSYYQDPAKCNPEG- 170

  Fly   189 GGKLPMD-----CSG 198
            ....|||     |.|
Zfish   171 NPDFPMDSHNTNCKG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 44/133 (33%)
7tm_4 223..544 CDD:304433
frzbNP_571018.1 CRD_SFRP3 28..153 CDD:143550 43/140 (31%)
NTR_Sfrp3_like 200..310 CDD:239636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.