Sequence 1: | NP_511068.2 | Gene: | fz4 / 31659 | FlyBaseID: | FBgn0027342 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571018.1 | Gene: | frzb / 30119 | ZFINID: | ZDB-GENE-990715-1 | Length: | 315 | Species: | Danio rerio |
Alignment Length: | 210 | Identity: | 63/210 - (30%) |
---|---|---|---|
Similarity: | 91/210 - (43%) | Gaps: | 52/210 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 CIL---CLLVVILLHPRISKSSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPN 66
Fly 67 LVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCH 131
Fly 132 PVLQGFGFPWPPALDCDKFPRENNHETMCM--------EGPGELHQPQQEQDLYGLPGQGIPGGL 188
Fly 189 GGKLPMD-----CSG 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz4 | NP_511068.2 | CRD_FZ4 | 43..169 | CDD:143557 | 44/133 (33%) |
7tm_4 | 223..544 | CDD:304433 | |||
frzb | NP_571018.1 | CRD_SFRP3 | 28..153 | CDD:143550 | 43/140 (31%) |
NTR_Sfrp3_like | 200..310 | CDD:239636 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |