Sequence 1: | NP_511068.2 | Gene: | fz4 / 31659 | FlyBaseID: | FBgn0027342 | Length: | 705 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_872279.2 | Gene: | Corin / 289596 | RGDID: | 727887 | Length: | 1111 | Species: | Rattus norvegicus |
Alignment Length: | 195 | Identity: | 55/195 - (28%) |
---|---|---|---|
Similarity: | 80/195 - (41%) | Gaps: | 35/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 SSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQT--FA 84
Fly 85 PLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDK 149
Fly 150 FPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRC 214
Fly 215 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fz4 | NP_511068.2 | CRD_FZ4 | 43..169 | CDD:143557 | 39/127 (31%) |
7tm_4 | 223..544 | CDD:304433 | |||
Corin | NP_872279.2 | DDNN motif | 93..96 | ||
CRD_corin_1 | 200..329 | CDD:143554 | |||
LDLa | 335..370 | CDD:238060 | |||
LDLa | 372..406 | CDD:238060 | |||
Ldl_recept_a | 413..443 | CDD:395011 | |||
LDLa | 453..480 | CDD:238060 | |||
CRD_corin_2 | 521..641 | CDD:143579 | 41/137 (30%) | ||
Ldl_recept_a | 646..680 | CDD:395011 | 9/19 (47%) | ||
LDLa | <693..718 | CDD:238060 | |||
LDLa | 721..755 | CDD:238060 | |||
SRCR_2 | 779..859 | CDD:413346 | |||
Tryp_SPc | 867..1098 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |