DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and Corin

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_872279.2 Gene:Corin / 289596 RGDID:727887 Length:1111 Species:Rattus norvegicus


Alignment Length:195 Identity:55/195 - (28%)
Similarity:80/195 - (41%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQT--FA 84
            ||...:.:.||...|...:.....||.|.:|:|..:.||.|..||.:|:..|.:...:.::  |.
  Rat   497 SSCVESCAGSSLCDSDSSLSNCSHCEPITLELCMNLPYNLTHYPNYLGHRTQKEASISWESALFP 561

  Fly    85 PLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDK 149
            .|::.:|...|..|.|...||.|..... ..:.|||.|||..:.||..||...|..||...||.:
  Rat   562 ALVQTNCYKYLMFFACTILVPKCDVNTG-QRVPPCRLLCEHSKERCESVLGIVGLQWPEDTDCSQ 625

  Fly   150 FPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRC 214
            ||.:::....|:                 ||.:.:.         :||   .||...   |||||
  Rat   626 FPEQSSDNQTCL-----------------LPNEDVE---------ECS---PSHFKC---RSGRC 658

  Fly   215  214
              Rat   659  658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 39/127 (31%)
7tm_4 223..544 CDD:304433
CorinNP_872279.2 DDNN motif 93..96
CRD_corin_1 200..329 CDD:143554
LDLa 335..370 CDD:238060
LDLa 372..406 CDD:238060
Ldl_recept_a 413..443 CDD:395011
LDLa 453..480 CDD:238060
CRD_corin_2 521..641 CDD:143579 41/137 (30%)
Ldl_recept_a 646..680 CDD:395011 9/19 (47%)
LDLa <693..718 CDD:238060
LDLa 721..755 CDD:238060
SRCR_2 779..859 CDD:413346
Tryp_SPc 867..1098 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.