DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and Frzb

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_035486.1 Gene:Frzb / 20378 MGIID:892032 Length:323 Species:Mus musculus


Alignment Length:216 Identity:57/216 - (26%)
Similarity:85/216 - (39%) Gaps:59/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCLLVVILLHPRISKSSTSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNE 71
            ||||.|               |.|.:::           ||.:||.:|:.:.:|.|.|||.:.:.
Mouse    22 LCLLQV---------------PGAQAAA-----------CEPVRIPLCKSLPWNMTKMPNHLHHS 60

  Fly    72 MQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQG 136
            .|.:....::.|..|:...||..|..||||.|.|:||.......|.||:|:||..|..|.|:|..
Mouse    61 TQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIK 125

  Fly   137 FGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMD-----C 196
            :...||.:|.||:.|..:  ..:|                  :..:.|....|...|||     |
Mouse   126 YRHSWPESLACDELPVYD--RGVC------------------ISPEAIVTADGADFPMDSSTGHC 170

  Fly   197 SGLAKSHLYVRLPRSGRCAPL 217
            .|.:....        :|.|:
Mouse   171 RGASSERC--------KCKPV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 41/125 (33%)
7tm_4 223..544 CDD:304433
FrzbNP_035486.1 CRD_SFRP3 32..157 CDD:143550 42/155 (27%)
NTR_Sfrp3_like 188..297 CDD:239636
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.