DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and Sfrp1

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_038862.2 Gene:Sfrp1 / 20377 MGIID:892014 Length:314 Species:Mus musculus


Alignment Length:175 Identity:56/175 - (32%)
Similarity:88/175 - (50%) Gaps:19/175 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILCLLVVILL-------HPRISKSSTSGNPSASSSSSSPPEIPAFRQCETIRIE--MCRKIGYNE 61
            :|..|...||       :..:|..|..|:..:....:.||      ||..|.::  :|..:||.:
Mouse    17 VLLALAAALLAAGSASEYDYVSFQSDIGSYQSGRFYTKPP------QCVDIPVDLRLCHNVGYKK 75

  Fly    62 TSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESV 126
            ..:|||:.:|...:|:....::.||:..:|....::|||:.:.|:|..: |::   |||.|||:|
Mouse    76 MVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDR-PIY---PCRWLCEAV 136

  Fly   127 RIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQ 171
            |..|.||:|.|||.||..|.|||||..:....|......|..:||
Mouse   137 RDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNTTEASKPQ 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 45/127 (35%)
7tm_4 223..544 CDD:304433
Sfrp1NP_038862.2 CRD_SFRP1 52..175 CDD:143552 46/132 (35%)
NTR_Sfrp1_like 183..306 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.