DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and Sfrp2

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_033170.1 Gene:Sfrp2 / 20319 MGIID:108078 Length:295 Species:Mus musculus


Alignment Length:237 Identity:69/237 - (29%)
Similarity:96/237 - (40%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVVILLHPRISKSS---TSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGN 70
            ||:|:..|..:..:.   ..|.|..|...|:...|||       .:::|..|.|....:|||:|:
Mouse     9 LLLVLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPA-------NLQLCHGIEYQNMRLPNLLGH 66

  Fly    71 EMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQ 135
            |...:|......:.||:...|....|.|||:.:.|:|..... ..|.||.|||..|:.||.||:.
Mouse    67 ETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLD-ETIQPCHSLCVQVKDRCAPVMS 130

  Fly   136 GFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLA 200
            .||||||..|:||:||::|                    ||                   |..||
Mouse   131 AFGFPWPDMLECDRFPQDN--------------------DL-------------------CIPLA 156

  Fly   201 KS-HLYVRLPRSGRCAPLCEA---------DILFTPAEKHLA 232
            .| ||   ||.:.....:|||         ||:.|..:...|
Mouse   157 SSDHL---LPATEEAPKVCEACKTKNEDDNDIMETLCKNDFA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 41/125 (33%)
7tm_4 223..544 CDD:304433 2/10 (20%)
Sfrp2NP_033170.1 CRD_SFRP2 36..163 CDD:143555 53/176 (30%)
NTR_Sfrp1_like 169..295 CDD:239635 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5843
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.