DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and sfrp-1

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_500977.2 Gene:sfrp-1 / 177401 WormBaseID:WBGene00022242 Length:314 Species:Caenorhabditis elegans


Alignment Length:158 Identity:43/158 - (27%)
Similarity:80/158 - (50%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVVILLHPRISKSSTSG--NPSASSSSSSPPEIPAFRQCETI--RIEMCRKIGYNETSMPNLVG 69
            :::..:|:...:.|.|:|  ..|.:..||..|..|   :|..|  .:.:|..|.|.:..:||::.
 Worm     1 MMLFPVLYILFAFSVTNGYLEDSWAMFSSERPVGP---KCVDIPSNLSICNGIEYTQMRLPNILE 62

  Fly    70 NEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVL 134
            :|..::..:..:.:..|:..:|....:.|||:.:.|:|..:.. ..|.||:|||.:|:..|...:
 Worm    63 HETVSEAIHASKDWESLLRLNCHPDTQRFLCSLFAPVCLMQMD-RLILPCKSLCMAVKQGCENRM 126

  Fly   135 QGFGFPWPPALDCDKFPRENNHETMCME 162
            ..:|||||..|.|:||    ..:.||::
 Worm   127 ANYGFPWPEMLSCEKF----EDDDMCIK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 34/122 (28%)
7tm_4 223..544 CDD:304433
sfrp-1NP_500977.2 CRD_FZ 37..161 CDD:382974 34/119 (29%)
NTR_Sfrp1_like 162..283 CDD:239635
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.