DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and mfrp

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_009289590.1 Gene:mfrp / 101885305 ZFINID:ZDB-GENE-160728-150 Length:572 Species:Danio rerio


Alignment Length:128 Identity:38/128 - (29%)
Similarity:67/128 - (52%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNL-VGNEMQTDVEYTLQTFAPLIEYDCSSQLK 96
            :|:.||...:   ||.|::||||.:.||.||.||: :....|.:....|..:..|::..|....:
Zfish   449 NSTYPPFTSS---CELIQVEMCRDLSYNLTSFPNIWLSLSDQREAASILHKYRVLVDLPCFESFR 510

  Fly    97 LFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETM 159
            ..:|..::|.|:|::.|..:  |:|:|.:..::|.|.|..|...||  .:|...|  ::|:.|
Zfish   511 QLVCGMFLPRCSPQSGVLQL--CQSVCSTAELQCSPALSLFSLNWP--FNCLLLP--DSHDPM 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 35/118 (30%)
7tm_4 223..544 CDD:304433
mfrpXP_009289590.1 CUB 138..248 CDD:238001
LDLa 256..290 CDD:238060
CUB 297..405 CDD:238001
LDLa 413..447 CDD:238060
Fz 459..563 CDD:279700 33/109 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.