DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and corin

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:XP_004911266.2 Gene:corin / 100492163 XenbaseID:XB-GENE-950958 Length:1123 Species:Xenopus tropicalis


Alignment Length:390 Identity:93/390 - (23%)
Similarity:136/390 - (34%) Gaps:121/390 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QCETIRIEMCRKIGYNETSMPNLVGNEMQTD--VEYTLQTFAPLIEYDCSSQLKLFLCAAYVPMC 107
            |||.|.:|:|..:.||.|:.||.:|:..|.:  :.:....|..|::.:|...|..|.|...||.|
 Frog   533 QCEPITLELCINLPYNYTTFPNYLGHRTQKEASISWESSLFPALVQTNCYKYLMYFACTILVPKC 597

  Fly   108 TPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELHQPQQ 172
            .|:.. ..|.|||||||..:.||..||...|..||...||.:||.|.:....|:           
 Frog   598 EPETH-QRIPPCRSLCEHSKERCESVLGIVGLQWPEDTDCTQFPDEKSDNQTCL----------- 650

  Fly   173 EQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGRC---APLC--EADILFTPAEKHLA 232
                  :|.:.:.         :||   .||...   |||||   :..|  |||......|::  
 Frog   651 ------MPDEDVE---------ECS---PSHYKC---RSGRCILASRRCDGEADCEDDSDEEN-- 692

  Fly   233 EIWVSTWAYAALGLALVATVCLLASDGSRLASAKWSRLLSPLIWCHNMVTLGWAVRFMVGRTGTA 297
                                |..|..|      .|...::.:...|:|:                
 Frog   693 --------------------CECAERG------LWECPVNKMCIKHSMI---------------- 715

  Fly   298 CGTDPQAPNE------SLLTVDGLSNASCASVFLMRYYFGMAACA-----WWAVLCLGWHRDIRR 351
            |...|..|.|      |..|.:.|..|:...|...|:..|:..|.     |   .|:...:.:..
 Frog   716 CDGFPDCPEELEEKNCSSCTSEELECANHECVSRDRWCDGLIDCTDGSDEW---NCVTLSKSVSS 777

  Fly   352 ------HSPDSKGHVVIPSNFGGSPAKRNSAKTAQQDLTQNNFVC-FVAWGLPAFQTSAVIVARF 409
                  |...|..||              .|...:::|||  :|| .:..|.|:....|..:..|
 Frog   778 LTFLTIHRSASDYHV--------------CADDWEEELTQ--WVCNQLGLGGPSITAEATELDHF 826

  Fly   410  409
             Frog   827  826

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 44/125 (35%)
7tm_4 223..544 CDD:304433 35/205 (17%)
corinXP_004911266.2 CRD_corin_1 213..341 CDD:143554
LDLa 351..382 CDD:238060
LDLa 384..418 CDD:238060
LDLa 420..455 CDD:238060
LDLa 465..492 CDD:238060
CRD_corin_2 533..654 CDD:143579 45/138 (33%)
LDLa 659..693 CDD:238060 14/61 (23%)
LDLa 734..768 CDD:238060 8/36 (22%)
Tryp_SPc 883..1114 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.