DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fz4 and sfrp1

DIOPT Version :9

Sequence 1:NP_511068.2 Gene:fz4 / 31659 FlyBaseID:FBgn0027342 Length:705 Species:Drosophila melanogaster
Sequence 2:NP_001116878.1 Gene:sfrp1 / 100038100 XenbaseID:XB-GENE-488230 Length:311 Species:Xenopus tropicalis


Alignment Length:195 Identity:60/195 - (30%)
Similarity:91/195 - (46%) Gaps:50/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PAFRQCETIRIEM--CRKIGYNETSMPNLVGNEMQTDVEYTLQTFAPLIEYDCSSQLKLFLCAAY 103
            ||  ||..|..:|  |..:|||:..:|||:.:|...:|:|...::.||:...|....::|||:.:
 Frog    51 PA--QCVEIPQDMTLCHGVGYNKMVLPNLLDHETMAEVKYQASSWVPLLSKKCHPGTQVFLCSLF 113

  Fly   104 VPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWPPALDCDKFPRENNHETMCMEGPGELH 168
            .|:|..: ||:   |||.||||||..|.||:|.|||.||..|.|:::|.|   |.:|:    .:|
 Frog   114 APVCLDR-PVY---PCRRLCESVRDACEPVMQYFGFHWPEMLRCEQYPTE---EDVCI----AVH 167

  Fly   169 QPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKSHLYVRLPRSGR--CAPLCEADILFTPAEKHL 231
            .|...|                                 .|||.:  ..|.|:::|......:|:
 Frog   168 LPNATQ---------------------------------APRSRKTEVCPQCDSEIKADSLYEHM 199

  Fly   232  231
             Frog   200  199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fz4NP_511068.2 CRD_FZ4 43..169 CDD:143557 48/127 (38%)
7tm_4 223..544 CDD:304433 1/9 (11%)
sfrp1NP_001116878.1 CRD_SFRP1 48..172 CDD:143552 52/133 (39%)
NTR_Sfrp1_like 180..303 CDD:239635 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.