DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8300 and zgc:153383

DIOPT Version :9

Sequence 1:NP_572384.1 Gene:CG8300 / 31658 FlyBaseID:FBgn0029937 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_005168149.1 Gene:zgc:153383 / 751751 ZFINID:ZDB-GENE-060825-178 Length:205 Species:Danio rerio


Alignment Length:171 Identity:40/171 - (23%)
Similarity:75/171 - (43%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ETDNVSALELQSN--------------KRMLYFSDG-VMEELSSGSEDEADAEMGDKCYDVHLNE 79
            |.|.:|..|.:..              :|:::||.| .|||.|: .|:|.:.:...|......:.
Zfish    20 EPDKISGKEKEYECVELGDLDRKEKIPRRIIHFSSGETMEEYST-DEEEDNKQNAKKDLLSSRDA 83

  Fly    80 SEMPLGPRLRYKASRMGNRFLAGIDYVGGGLAHLLGITSSKYASELENYHRAKEHGDEDLDNWHP 144
            |.:.|||.:.:...|.....::..||:|..:|.|.||||:||...::.|.|:|...::..::.| 
Zfish    84 SNLTLGPYVWFHMWRAATSTISACDYLGERMASLFGITSAKYQYAIDEYSRSKREKEDRNEDTH- 147

  Fly   145 RAMSTTTSSSNNNSSGNNNRNETIVLCEPTRSEATLPPTRQ 185
                .:..:.:......|:.:|.:...:|..|...:..|.:
Zfish   148 ----LSEEAEHLFKEQRNDEDEDLKTDQPETSRHEVQVTNE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8300NP_572384.1 FAM177 30..140 CDD:291440 34/124 (27%)
zgc:153383XP_005168149.1 FAM177 33..145 CDD:291440 30/112 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590165
Domainoid 1 1.000 56 1.000 Domainoid score I11014
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5432
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1572938at2759
OrthoFinder 1 1.000 - - FOG0004847
OrthoInspector 1 1.000 - - otm24918
orthoMCL 1 0.900 - - OOG6_106873
Panther 1 1.100 - - O PTHR31206
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5191
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.