DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8300 and fam177a1

DIOPT Version :9

Sequence 1:NP_572384.1 Gene:CG8300 / 31658 FlyBaseID:FBgn0029937 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001016500.1 Gene:fam177a1 / 549254 XenbaseID:XB-GENE-962837 Length:190 Species:Xenopus tropicalis


Alignment Length:107 Identity:27/107 - (25%)
Similarity:53/107 - (49%) Gaps:24/107 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KRMLYFSDG-VMEELSSGSEDE----------ADAEMGDKCYDVHLNESEMPLGPRLRYKASRMG 96
            :|:::|:.| .|||.|:..|:|          ||             .|::..||.|.:...|:.
 Frog    32 RRIIHFASGETMEEYSTDEEEELQERKEVLPAAD-------------PSKLTWGPYLWFYMLRVA 83

  Fly    97 NRFLAGIDYVGGGLAHLLGITSSKYASELENYHRAKEHGDED 138
            ...|:..|::|..:|.:||:::.||...::.|:|.::..:|:
 Frog    84 TSTLSVCDFLGEKIASVLGVSTPKYQYAIDEYYRMQKEAEEE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8300NP_572384.1 FAM177 30..140 CDD:291440 27/107 (25%)
fam177a1NP_001016500.1 FAM177 19..120 CDD:291440 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1572938at2759
OrthoFinder 1 1.000 - - FOG0004847
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5191
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.